KEGG   Homo sapiens (human): 400916Help
Entry
400916            CDS       T01001                                 

Gene name
CHCHD10, C22orf16, FTDALS2, IMMD, N27C7-4, SMAJ
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 10
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WYQ3(Tbio)
UniProt: 
Position
22q11.23
AA seq 142 aa AA seqDB search
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSA
VGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLS
LCEGFSEALKQCKYYHGLSSLP
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggggaagccgcagcgcggcctcccggccagccagccgcccagccgcgccctct
gcccacccgcccgcgcacccaccgccctcggcagccgccccagcccccgccccttcgggc
cagccggggctcatggctcagatggcgaccacggccgcaggggtagccgtgggctcggct
gtgggacacgtcatgggcagcgccctgaccggagccttcagcggggggagctcggagccc
tcccagcctgctgtccagcaggcccccacccccgctgccccccagcccctgcagatgggg
ccctgcgcctacgagatcaggcagttcctggactgttccaccactcagagtgacctgtcc
ctgtgtgagggcttcagcgaggccctgaagcagtgcaagtactaccatggtctgagctcc
ctgccctga

DBGET integrated database retrieval system