KEGG   Homo sapiens (human): 4012Help
Entry
4012              CDS       T01001                                 

Gene name
LNPEP, CAP, IRAP, P-LAP, PLAP
Definition
leucyl/cystinyl aminopeptidase (EC:3.4.11.3)
Orthology
K01257  
cystinyl aminopeptidase [EC:3.4.11.3]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q15
AA seq 1025 aa AA seqDB search
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttcaccaatgatcggcttcagctccccaggaatatgattgaaaacagcatg
tttgaggaagaaccagatgtggtggatttagccaaagagccttgtttacatcctctagag
cctgatgaggtggaatatgagccccggggttcccgactgctggtgcggggtcttggtgag
catgagatggaggaggatgaagaggattatgagtcatcagcaaagctgctgggcatgtcc
ttcatgaatagaagctcaggccttcggaacagtgcaactggttacaggcagagcccagat
ggggcttgttcagtaccctctgcaaggaccatggtggtctgtgcttttgtcatcgtggtt
gctgtttctgtaatcatggtgatttacttactgcccagatgtacctttaccaaagaaggc
tgccataaaaaaaaccagtcaattggactaattcagccatttgcaacaaatgggaaattg
tttccatgggcacagatcaggcttcccactgccgttgtgccactacgctatgaactcagc
ctacacccgaacctaacctcgatgacattcaggggttctgtgacaatttcagttcaggct
cttcaggtcacatggaatatcattcttcatagcacaggtcataatatttcaagagtgacc
tttatgtcagcagtttcaagccaagaaaaacaagctgagatcctggaatatgcatatcat
ggacagatcgccattgttgcccccgaagcccttctagcagggcacaattatacgttgaag
atagagtactcggcaaatatatctagttcttattatgggttttatggcttctcctacaca
gatgaaagtaatgagaaaaagtactttgcagcaactcagtttgaacccctggcagcaaga
tctgcttttccttgttttgatgaaccagcatttaaagccacttttatcatcaagatcata
agggatgagcaatacaccgctttatcaaatatgcctaagaagtcatcagtcgttctagat
gatggacttgttcaggatgagttttctgagagtgtgaagatgagcacttacttggttgct
ttcattgtgggagagatgaagaacctgagtcaggacgtaaatggaaccctggtttctata
tatgctgtaccagaaaagattggtcaagttcattatgccttggaaacaactgtgaagctt
cttgagttttttcaaaactactttgaaattcagtacccacttaagaaattggatttggtg
gctattcctgactttgaagcaggagcaatggaaaattggggtttgctcaccttccgagag
gagacacttctgtatgacagtaacacttcttcaatggcggatagaaagctggtgactaaa
atcattgctcatgagctggcccaccagtggtttggcaatctggtaacaatgaagtggtgg
aatgacctatggctaaatgaaggttttgccactttcatggagtatttctctttggaaaaa
atattcaaagagctttctagttatgaagatttcttagatgctcgatttaaaaccatgaag
aaagattccttaaattcatctcatccaatatcatcatctgttcagtcttcagaacaaatt
gaagaaatgtttgattctctttcctattttaagggatcttctctcttgttgatgttgaaa
acttaccttagtgaagatgtgtttcaacatgctgttgtcctttacctgcataatcacagc
tatgcatctattcaaagtgatgatctgtgggatagttttaatgaggtcacaaaccaaaca
ctagatgtaaagagaatgatgaaaacctggaccctgcagaaaggatttcctttagtgact
gttcaaaagaaaggaaaggaactttttatacaacaagagagattctttttaaatatgaag
cctgaaattcagccttcagatacaagctacctgtggcatattccactatcctatgtcact
gaaggaagaaattattcaaaatatcaatcggtatcattactggataagaaatcaggtgtc
atcaatcttacagaagaagtgctgtgggtcaaagtgaatataaacatgaatggttattat
attgtacactatgcagatgatgattgggaagcactaatccatcagttgaaaataaatcct
tatgttctgagtgacaaagaccgagccaaccttatcaacaacatctttgaacttgcaggc
ctaggcaaggtacctctcaagagggcctttgatttgattaattatcttggaaatgagaac
catactgcacccatcaccgaagccctgtttcagacagacctcatctataacctccttgaa
aaactgggatacatggatctggcctcaagactggtgactagggtatttaaattacttcaa
aaccaaattcaacaacaaacttggactgatgagggcactccatctatgcgagagcttcgg
tcagccctgctagagtttgcttgcacccacaacctggggaactgctctactactgccatg
aaactgtttgatgactggatggcatccaatggaactcaaagcctacctactgatgtcatg
acaactgtgttcaaagttggagcaaaaactgacaaaggctggtcattccttttgggcaaa
tacatttctataggctctgaagcagagaagaacaaaatactagaagcacttgccagctca
gaggatgtgcggaagctttactggttaatgaaaagtagcctgaatggagataacttccga
acacagaagctgtcttttatcattagaacagtgggtcgacattttcctggacacttactg
gcatgggattttgtcaaagagaactggaataagcttgtacagaagttccctctggggtcc
tataccatacaaaatattgttgctggatcaacttacctgttttcaacaaagacacattta
tctgaggttcaggcattctttgaaaatcagtcagaggcaaccttccggcttcgttgtgtc
caggaggctttggaagtcattcagttgaatatccagtggatggagaagaacctcaaaagt
ctcacatggtggctgtag

DBGET integrated database retrieval system