KEGG   Homo sapiens (human): 401207Help
Entry
401207            CDS       T01001                                 

Gene name
C5orf63, YDR286C
Definition
chromosome 5 open reading frame 63
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
UniProt: 
Position
5q23.2
AA seq 115 aa AA seqDB search
MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRFIL
QEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQLLKLEQQSTGG
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctctggtttcaaggaaatagcatgcaacttgccagatcctcctttggactcttcttg
agaaattgctctgcctctaagacaactctgcctgtgttgaccttattcacaaaggaccca
tgccccctttgtgatgaagccaaggaagtactcaagccttatgaaaacaggttcatttta
caggaggtgaacatcacacttccagaaaactctgtctggtatgaaaggtataaatttgat
attcctgtctttcacttgaatggccagtttctgatgatgcatcgagtaaacacctcaaaa
cttgaaaaacagctcctgaaacttgagcagcaaagtactggaggctga

DBGET integrated database retrieval system