KEGG   Homo sapiens (human): 402135Help
Entry
402135            CDS       T01001                                 

Gene name
OR5K2, OR3-9
Definition
(RefSeq) olfactory receptor family 5 subfamily K member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    402135 (OR5K2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    402135 (OR5K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 402135
NCBI-ProteinID: NP_001004737
HGNC: 14774
Ensembl: ENSG00000231861
Vega: OTTHUMG00000160049
Pharos: Q8NHB8(Tdark)
UniProt: Q8NHB8 A0A126GVB4
Position
3q11.2
AA seq 316 aa AA seqDB search
MVEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHCRLHTPMY
IFLGNLALVDSCCACAITPKMLENFFSEGKRISLYECAVQFYFLCTVETADCFLLAAVAY
DRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGLNHINHFYCD
TLPLYRLSCVDPFINELVLFIFSGSVQVFTIGSVLISYLYILLTIFRMKSKEGRAKAFST
CASHFSSVSLFYGSIFFLYIRPNLLEEGGNDIPAAILFTIVVPLLNPFIYSLRNKEVISV
LRKILLKIKSQGSVNK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagaaaatcataccatgaaaaatgagtttatcctcacaggatttacagatcac
cctgagctgaagactctgctgtttgtggtgttctttgccatctatctgatcaccgtggtg
gggaatattagtttggtggcactgatatttacacactgtcggcttcacacaccaatgtac
atctttctgggaaatctggctcttgtggattcttgctgtgcctgtgctattacccccaaa
atgttagagaacttcttttctgagggcaaaaggatttccctctatgaatgtgcagtacag
ttttattttctttgcactgtggaaactgcagactgctttcttctggcagcagtggcctat
gaccgctatgtggccatctgcaacccactgcagtaccacatcatgatgtccaagaaactc
tgcattcagatgaccacaggcgccttcatagctggaaatctgcattccatgattcatgta
gggcttgtatttaggttagttttctgtggattgaatcacatcaaccacttttactgtgat
actcttcccttgtatagactctcctgtgttgaccctttcatcaatgaactggttctattc
atcttctcaggttcagttcaagtctttaccataggtagtgtcttaatatcttatctctat
attcttcttactattttcagaatgaaatccaaggagggaagggccaaagccttttctact
tgtgcatcccacttttcatcagtttcattattctatggatctatttttttcctatacatt
agaccaaatttgcttgaagaaggaggtaatgatataccagctgctattttatttacaata
gtagttcccttactaaatcctttcatttatagtctgagaaacaaggaagtaataagtgtc
ttaagaaaaattctgctgaaaataaaatctcaaggaagtgtgaacaaatga

DBGET integrated database retrieval system