KEGG   Homo sapiens (human): 4023Help
Entry
4023              CDS       T01001                                 

Gene name
LPL, HDLCQ11, LIPD
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Disease
H00154  
Hyperlipoproteinemia, type I
H01635  
Hyperlipidemia
H01637  
Hypertriglyceridemia
H01784  
Primary hyperchylomicronemia
Drug target
Dextran (DG00180): 
Elastase ES: 
Ibrolipim: 
Omega-3-acid ethyl esters: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    4023 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4023 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    4023 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4023 (LPL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     4023 (LPL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   4023 (LPL)
  Exosomal proteins of breast milk
   4023 (LPL)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   4023 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  4023 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P06858(Tchem)
UniProt: 
Position
8p21.3
AA seq 475 aa AA seqDB search
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcgtgctgactctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcccggagta
gcagagtccgtggctacctgtcatttcaatcacagcagcaaaaccttcatggtgatccat
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaatgtcattgtggtggactggctgtcacgggctcaggagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgtctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggtcgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgcgtgattgcagagagaggacttggagatgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcatcgactctctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaatcag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttccacaaataagacctactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcatactttagctggtcagactgg
tggagcagtcccggcttcgccattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system