KEGG   Homo sapiens (human): 402317Help
Entry
402317            CDS       T01001                                 

Gene name
OR2A42
Definition
olfactory receptor, family 2, subfamily A, member 42
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    402317 (OR2A42)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    402317 (OR2A42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 310 aa AA seqDB search
MGENQTMVTEFLLLGFLLGPRIQMLLFGLFSLFYIFTLLGNGAILGLISLDSRLHTPMYF
FLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQTFLCLSFGHSECLLLVLMSYD
RYVAICHPLRYSVIMTWRVCITLAVTSWTCGSLLALAHVVLILRLPFSGPHEINHFFCEI
LSVLRLACADTWLNQVVIFAACVFFLVGPPSLVLVSYSHILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL
RRALGKESHS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaatcagacaatggtcacagagttcctcctactgggatttctcctgggccca
aggattcagatgctcctctttgggctcttctccctgttctatatcttcaccctgctgggg
aacggggccatcctggggctcatctcactggactccagactccacacccccatgtacttc
ttcctctcacacctggctgtcgtcgacatcgcctacacccgcaacacggtgccccagatg
ctggcgaacctcctgcatccagccaagcccatctcctttgctggttgcatgacgcagacc
tttctctgtttgagttttggacacagcgaatgtctcctgctggtgctgatgtcctacgat
cgttacgtggccatctgccaccctctccgatactccgtcatcatgacctggagagtctgc
atcaccctggccgtcacttcctggacgtgtggctccctcctggctctggcccatgtggtt
ctcatcctaagactgcccttctctgggcctcatgaaatcaaccacttcttctgtgaaatc
ctgtctgtcctcaggctggcctgtgctgacacctggctcaaccaggtggtcatctttgca
gcctgcgtgttcttcctggtggggccacccagcctggtgcttgtctcctactcgcacatc
ctggcggccatcctgaggatccagtctggggagggccgcagaaaggccttctccacctgc
tcctcccacctctgcgtggtgggactcttctttggcagtgccatcatcatgtacatggcc
cccaagtcccgccatcctgaggagcagcaaaaggtcttttttctattttacagttttttc
aacccaacacttaaccccctgatttacagcctgaggaacggagaggtcaagggtgccctg
aggagagcactgggcaaggaaagtcattcctaa

DBGET integrated database retrieval system