KEGG   Homo sapiens (human): 4026Help
Entry
4026              CDS       T01001                                 

Gene name
LPP
Definition
(RefSeq) LIM domain containing preferred translocation partner in lipoma
  KO
K16676  
lipoma-prefererred partner
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q93052(Tbio)
UniProt: 
Position
3q27.3-q28
AA seq 612 aa AA seqDB search
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR
IRVLTAKASTDL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacccatcttggctgccacccaaaagcactggtgagcccctcggccatgtgcct
gcacggatggagaccacccattcctttgggaaccccagcatttcagtgtctacacaacag
ccacccaaaaagtttgccccggtagttgctccaaaacctaagtacaacccatacaaacaa
cctggaggtgagggtgattttcttccacccccacctccacctctagatgattccagtgcc
cttccatctatctctggaaactttcctcctccaccacctcttgatgaagaggctttcaaa
gtacaggggaatcccggaggcaagacacttgaggagaggcgctccagcctggacgctgag
attgactccttgaccagcatcttggctgaccttgagtgcagctccccctataagcctcgg
cctccacagagctccactggttcaacagcctctcctccagtttcgaccccagtcacagga
cacaagagaatggtcatcccgaaccaaccccctctaacagcaaccaagaagtctacattg
aaaccacagcctgcaccccaggctggacccatccctgtggctccaatcggaacactcaaa
ccccagcctcagccagtcccagcctcctacaccacggcctccacttcttcaaggcctacc
tttaatgtgcaggtgaagtcagcccagcccagccctcattatatggctgccccttcatca
ggacaaatttatggctcagggccccagggctataacactcagccagttcctgtctctggg
cagtgtccacctccttcaacacggggaggcatggattatgcctacattccaccaccagga
cttcagccggagcctgggtatgggtatgcccccaaccagggacgctattatgaaggctac
tatgcagcagggccaggctatgggggcagaaatgactctgaccctacctatggtcaacaa
ggtcacccaaatacctggaaacgggaaccagggtacactcctcctggagcagggaaccag
aaccctcctgggatgtatccagtcactggtcccaagaagacctatatcacagatcctgtt
tcagccccctgtgcgccaccattgcagccaaagggtggccattcagggcaactggggcct
tcgtcagttgccccttcattccgcccagaggatgagcttgagcacctgaccaaaaagatg
ctgtatgacatggaaaatccacctgctgacgaatactttggccgctgtgctcgctgtgga
gaaaacgtagttggggaaggtacaggatgcactgccatggatcaggtcttccacgtggat
tgttttacctgcatcatctgcaacaacaagctccgagggcagccattctatgctgtggaa
aagaaagcatactgcgagccctgctacattaatactctggagcagtgcaatgtgtgttcc
aagcccatcatggagcggattctccgagccaccgggaaggcctatcatcctcactgtttc
acctgcgtgatgtgccaccgcagcctggatgggatcccattcactgtggatgctggcggg
ctcattcactgcattgaggacttccacaagaaatttgccccgcgatgttctgtgtgcaag
gagcctattatgccagccccgggccaggaggagactgtccgtattgtggctttggatcga
gatttccatgttcactgctaccgatgcgaggattgcggtggtctcctgtctgaaggagat
aaccaaggctgctaccccttggatgggcacatcctctgcaagacctgcaactctgcccgc
atcagggtgttgaccgccaaggcgagcactgacctttag

DBGET integrated database retrieval system