KEGG   Homo sapiens (human): 403239Help
Entry
403239            CDS       T01001                                 

Gene name
OR2T27
Definition
olfactory receptor, family 2, subfamily T, member 27
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 317 aa AA seqDB search
MEQSNYSVYADFILLGLFSNARFPWLLFALILLVFLTSIASNVVKIILIHIDSRLHTPMY
FLLSQLSLRDILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSY
DRYVAICNPLHYPVLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCE
VPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRGKAVAT
CSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGA
LQKVVGRCVSSGKVTTF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagcaattattccgtgtatgccgactttatccttctgggtttgttcagcaac
gcccgtttcccctggcttctctttgccctcattctcctggtctttttgacctccatagcc
agcaacgtggtcaagatcattctcatccacatagactcccgcctccacacccccatgtac
ttcctgctcagccagctctccctcagggacatcctgtatatttccaccattgtgcccaaa
atgctggtcgaccaggtgatgagccagagagccatttcctttgctggatgcactgcccaa
cacttcctctacttgaccttagcaggggctgagttcttcctcctaggactcatgtcctat
gatcgctacgtagccatctgcaaccctctgcactatcctgtcctcatgagccgcaagatc
tgctggttgattgtggcggcagcctggctgggagggtctatcgatggtttcttgctcacc
cccgtcaccatgcagttccccttctgtgcctctcgggagatcaaccacttcttctgcgag
gtgcctgcccttctgaagctctcctgcacggacacatcagcctacgagacagccatgtat
gtctgctgtattatgatgctcctcatccctttctctgtcatctcgggctcttacacaaga
attctcattactgtttataggatgagcgaggcagaggggaggggaaaggctgtggccacc
tgctcctcacacatggtggttgtcagcctcttctatggggctgccatgtacacatacgtg
ctgcctcattcttaccacacccctgagcaggacaaagctgtatctgccttctacaccatc
cttactcccatgctcaatccactcatttacagccttaggaacaaggatgtcacaggggcc
ctacagaaggttgtggggaggtgtgtgtcctcaggaaaggtaaccactttctaa

DBGET integrated database retrieval system