KEGG   Homo sapiens (human): 403253Help
Entry
403253            CDS       T01001                                 

Gene name
OR4A47, OR11-113
Definition
(RefSeq) olfactory receptor family 4 subfamily A member 47
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403253 (OR4A47)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403253 (OR4A47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 403253
NCBI-ProteinID: NP_001005512
HGNC: 31266
Ensembl: ENSG00000237388
Vega: OTTHUMG00000166581
Pharos: Q6IF82(Tdark)
UniProt: Q6IF82
Position
11p11.2
AA seq 309 aa AA seqDB search
MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF
LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC
YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY
PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS
HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLW
RRDLISSST
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagccaaggaaaaatgtgactgactttgtcctcttgggcttcacacagaatccaaag
gagcagaaagtactttttgttatgttcttgctcttctacattttgaccatggtgggcaac
ctgctcattgtagtgaccgtaactgtcagtgagaccctgggctcaccaatgtacttcttt
cttgctggcttatcatttatagatatcatttattcttcatccatttcccccagattgatt
tcaggcttgttctttgggaataattccatatccttccaatcttgcatggcccagctcttt
atcgagcacattttcggtgggtcagaggtctttctcctgttggtgatggcctatgactgc
tatgtggccatctgtaagcccttgcattatttggttatcatgagacaatgggtgtgtgtt
gtgctgctggtagtgtcctgggttggaggatttctgcactcagtatttcaacttagcatt
atttatgggctcccattctgtggccccaatgtcattgatcattttttctgtgacatgtat
cccttattgaaactggtctgcactgacacccatgctattggcctcttagtggtggccaat
ggaggactggcttgcactattgtgtttctgctcttactcatctcttatggtgtcatcttg
cactctttaaagaaccttagtcagaaagggaggcaaaaagccctctcaacctgcagttcc
cacatgactgtggttgtcttcttctttgttccttgtatttttatgtatgctagacctgct
aggaccttccccattgacaaatcagtgagtgtgttttatacagtcataaccccaatgctg
aaccccttaatctacactctgagaaattctgagatgacaagtgctatgaagaagctctgg
agaagagacctcatatcaagtagtacataa

DBGET integrated database retrieval system