KEGG   Homo sapiens (human): 403257Help
Entry
403257            CDS       T01001                                 

Gene name
OR4C45
Definition
olfactory receptor, family 4, subfamily C, member 45
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403257 (OR4C45)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403257 (OR4C45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Position
11p11.12
AA seq 306 aa AA seqDB search
MNNVTEFILLGLTHNPELQKFLFVMFLITYLITLAGNLLISVIIFISPALGSPMYLFLSY
LSIIDIFYSSSIAPKMIFDLISENNTISFNGCMTQLFTEHFFAAAETILLSVMAYDCYVA
ICKPLHYATIMTQSMCGFLMVVAGILGFVHGGIQTLFIAQLPFCGPNVIDHFMCDLVPLL
ELACTDTHTLGPLIAANSGSLCFLIFSILDASYVIILCSLRSHSSEGHLKALSSCASHIF
TVILFFVPCSYLYLRPLTSFPTDKAVTVFCTLFTPMLNPLIYTVKNKAVKNVIKKLWKQI
MTTDDK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgtaacagaattcatcctgctgggcctcactcacaatccagaactgcagaaa
ttcctgtttgttatgtttttaatcacctacttgatcacactggcaggtaacctgctcatc
tcagtcatcatcttcatcagcccagccctgggttcccccatgtacctttttctgtcctat
ttatccattatagatattttctactcttcttccatagcccctaaaatgatctttgacttg
atctctgaaaacaacaccatatccttcaatggctgcatgactcagctcttcacagaacat
ttctttgcggcagctgagaccatcttattaagtgtcatggcctacgactgctatgtggcc
atctgtaagcccttgcactatgcaaccatcatgacccaatctatgtgtggattcctgatg
gtggtggctggaattctgggatttgtgcatggaggaatccagactttgttcatagcccag
ttaccattctgtggccccaatgtcatcgaccactttatgtgtgatttagtacctcttctg
gagctggcctgcacagacactcacactttagggcctctgattgctgccaacagtgggtca
ctgtgtttcctcattttttccatactggatgcttcctatgtcatcatcttgtgctcccta
aggtctcatagctctgaagggcatctcaaagctctgtctagttgtgcctctcatatcttc
actgtcatcttattctttgtcccttgttcatacctgtatctaagacctctaacctccttc
cccactgacaaagctgtgactgtgttttgcaccctatttacacctatgttgaacccttta
atctacactgtcaaaaataaagcagtgaaaaatgtcattaagaagctctggaagcaaata
atgacaactgatgataaataa

DBGET integrated database retrieval system