KEGG   Homo sapiens (human): 403277Help
Entry
403277            CDS       T01001                                 

Gene name
OR5K3
Definition
(RefSeq) olfactory receptor family 5 subfamily K member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403277 (OR5K3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403277 (OR5K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF2805
Motif
Other DBs
NCBI-GeneID: 403277
NCBI-ProteinID: NP_001005516
HGNC: 31290
Ensembl: ENSG00000206536
Vega: OTTHUMG00000160077
Pharos: A6NET4(Tdark)
UniProt: A6NET4
Position
3q11.2
AA seq 321 aa AA seqDB search
MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMY
IFLGNLVLMDSCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAY
DCYVAICNPLQYHTMMSKTLCIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCD
VLPLYRLSCINPYINELVLFILAGSIQIFTIVLVSYFYILFTIFTMKSKEGRGKALSTCA
SHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINIMK
KIMKKRKFCHILKQMSSPLAT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggagaatcactccttgatagctgagttcatcctcacaggatttacatatcat
ccaaagctgaagactgttctgtttgtggtgttctttgccatctatctgatcaccatggtg
gggaacattggtttggtggcattgatttatatagagcaacgtcttcacacaccaatgtac
atatttttaggcaacctagttctgatggattcctgctgttcctctgctattactcccaag
atgttagagaacttcttttctgaggacaaaaggattaccctgtatgaatgtatggcacaa
ttttattttctctgtcttgctgaaactacagactgctttcttctggcggcaatggcctat
gactgctatgtggccatatgcaacccactgcagtaccacaccatgatgtccaagacactc
tgcattcagatgactgcaggagcctacctagctggcaacctgcatcccatgattgaagta
gagtttctgttgaggttaactttctgtgggtctcatcaaatcaatcattttttctgtgat
gttcttccattatatagactttcttgtattaacccttatatcaatgaattggtgttattt
atcttggcaggatcaattcaaatctttactatagtcttagtttcttatttctacatcctt
ttcacaatatttacaatgaaatccaaggagggaagaggcaaagctttatctacttgtgca
tctcactttctctctgtgtcaatattctgtgattcccttctcttcatgtatgctcgacca
ggtgcagttaatgaaggggataaagatatacctgttgctatattttatactttagttatt
cctttattaaatccttttatttatagcctaagaaataaggaagtaataaatattatgaaa
aaaattatgaagaagagaaaattttgtcacattctgaaacaaatgtcatcccctctggca
acttga

DBGET integrated database retrieval system