KEGG   Homo sapiens (human): 403282Help
Entry
403282            CDS       T01001                                 

Gene name
OR6C65
Definition
olfactory receptor, family 6, subfamily C, member 65
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403282 (OR6C65)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403282 (OR6C65)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MPNMTSIREFILLGFTDNPELQVVIFFFMLITYLLSVSGNMIIIMLTLSNIHLKTPMYFF
LRNFSFLEISFTTVFIPRFLINIATGDTTISYNASMAQVFFLILLGSTEFFLLAVMSYDR
YVAICKPLHYTTIMSNKVCNWLVISSWLAGFLIIFPPVIMGLQLDFCDSSTIDHFICDSS
PMLLIACTDTQFLELMAFLLAVFTLMVTLALVVLSYTLILKTILKIPSAQQRKKAFSTCS
SHMIVVSVSYGSCIFMCVKTSAKEGMALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALR
EFTKKILSLNKQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatatgacatcaattagagaattcattcttctgggatttacagataacccagag
ttacaagttgtgatattcttctttatgttgatcacatacttattgagtgtaagtggaaac
atgatcatcattatgttaacattgtcaaatattcatttgaaaactcctatgtatttcttc
ctcaggaatttctctttcttagaaatttcatttacgacagtcttcattcctagatttctg
atcaacattgctacaggagacacaaccatttcctataatgcttccatggcccaagtattt
tttttaattcttttgggatcaacagaattttttcttctggctgtcatgtcttatgatcgc
tatgtggctatctgcaaacctctacattatacaaccatcatgagtaacaaagtctgtaat
tggcttgtaatcagctcctggctggctggttttctcattatttttccccccgtgattatg
ggcctccaactggatttttgtgactccagcactattgaccatttcatctgtgattcttcc
cctatgctgctgattgcttgcacagacacacagtttctagagcttatggcatttttgcta
gcagtattcacactcatggtaactttggccttggtggttctctcctacacactcatcctt
aaaacaattctgaagattccctctgcccagcaaaggaaaaaggctttttcaacttgttcc
tcccatatgattgtggtttctgtttcttatgggagttgcatttttatgtgtgtaaaaaca
tctgcaaaagaaggtatggctttgagcaaaggtgtagcagtgcttaatacctctgttgct
cctatgttgaatccctttatttataccttaagaaaccagcaggtgaaacaggcccttagg
gaattcaccaaaaaaatattatcattgaacaagcaataa

DBGET integrated database retrieval system