KEGG   Homo sapiens (human): 403282Help
Entry
403282            CDS       T01001                                 

Gene name
OR6C65
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 65
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403282 (OR6C65)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403282 (OR6C65)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 403282
NCBI-ProteinID: NP_001005518
HGNC: 31295
Ensembl: ENSG00000205328
Vega: OTTHUMG00000169955
Pharos: A6NJZ3(Tdark)
UniProt: A6NJZ3 A0A126GW71
Position
12q13.2
AA seq 312 aa AA seqDB search
MPNMTSIREFILLGFTDNPELQVVIFFFMLITYLLSVSGNMIIIMLTLSNIHLKTPMYFF
LRNFSFLEISFTTVFIPRFLINIATGDTTISYNASMAQVFFLILLGSTEFFLLAVMSYDR
YVAICKPLHYTTIMSNKVCNWLVISSWLAGFLIIFPPVIMGLQLDFCDSSTIDHFICDSS
PMLLIACTDTQFLELMAFLLAVFTLMVTLALVVLSYTLILKTILKIPSAQQRKKAFSTCS
SHMIVVSVSYGSCIFMCVKTSAKEGMALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALR
EFTKKILSLNKQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatatgacatcaattagagaattcattcttctgggatttacagataacccagag
ttacaagttgtgatattcttctttatgttgatcacatacttattgagtgtaagtggaaac
atgatcatcattatgttaacattgtcaaatattcatttgaaaactcctatgtatttcttc
ctcaggaatttctctttcttagaaatttcatttacgacagtcttcattcctagatttctg
atcaacattgctacaggagacacaaccatttcctataatgcttccatggcccaagtattt
tttttaattcttttgggatcaacagaattttttcttctggctgtcatgtcttatgatcgc
tatgtggctatctgcaaacctctacattatacaaccatcatgagtaacaaagtctgtaat
tggcttgtaatcagctcctggctggctggttttctcattatttttccccccgtgattatg
ggcctccaactggatttttgtgactccagcactattgaccatttcatctgtgattcttcc
cctatgctgctgattgcttgcacagacacacagtttctagagcttatggcatttttgcta
gcagtattcacactcatggtaactttggccttggtggttctctcctacacactcatcctt
aaaacaattctgaagattccctctgcccagcaaaggaaaaaggctttttcaacttgttcc
tcccatatgattgtggtttctgtttcttatgggagttgcatttttatgtgtgtaaaaaca
tctgcaaaagaaggtatggctttgagcaaaggtgtagcagtgcttaatacctctgttgct
cctatgttgaatccctttatttataccttaagaaaccagcaggtgaaacaggcccttagg
gaattcaccaaaaaaatattatcattgaacaagcaataa

DBGET integrated database retrieval system