KEGG   Homo sapiens (human): 403284Help
Entry
403284            CDS       T01001                                 

Gene name
OR6C68
Definition
olfactory receptor, family 6, subfamily C, member 68
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 312 aa AA seqDB search
MRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIALTMLDPHLKTPMYFF
LQNLSFLEISFTATCVPRFLYSISTGNKIITYNACVIQLFFADLFGVTEFFLLATMSYDR
YVAICKPLHYMAIMSNKVCKTMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDAL
PILKIPCSDTSLIEQMVVASAVLTFIITLVCVVLSYTYIIRTILKFPSVQQKKKAFSTCS
SHITVVSITYGSCIFIYIKPSAKEEVNINKGVSVLISSISPMLNSFIYTLRNEQVKQAFH
DSLKKIAFRLKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacacacagcaataacaacattcatccttctgggactgacagaagatcctcag
ctgcaggttctgcttttcatgtttctatttatcacctacatgttgagtgtaacagggaaa
ctgaccattatcgccctcaccatgttggatccccacctgaaaacacccatgtattttttt
ctccaaaatttatctttcttagaaatctcatttacagctacctgtgttccaagattctta
tacagtatctcaactgggaacaaaataataacgtataatgcatgtgtcattcagctattt
tttgcagacctctttggggtaactgaattttttcttttggctaccatgtcatatgatcgc
tatgtggccatctgcaaacccttgcattatatggcaatcatgagcaacaaagtgtgcaaa
acaatggttatttgttgttggatggcagcacttatgattatcctcccaccacttagctta
ggttttcatctagaattctgtgactctaatgtcatcaatcattttggctgtgatgcattg
cctattctgaaaataccatgctcagacacatcattaattgagcagatggttgtagcctct
gctgtattaacctttattatcactcttgtatgtgtagttctgtcctacacatatatcata
agaacaattctaaaattcccttctgttcaacaaaagaaaaaagccttttctacctgttct
tcacatattactgtggtttccatcacttatggcagctgcatcttcatctatatcaagcca
tctgcaaaagaagaggtaaacattaataaaggtgtgtcagtgcttatttcatccatatca
cctatgttgaattctttcatatatactcttaggaatgagcaagttaaacaagcctttcat
gactcactcaaaaaaattgcatttcgtttaaaaaagtaa

DBGET integrated database retrieval system