KEGG   Homo sapiens (human): 403284Help
Entry
403284            CDS       T01001                                 

Gene name
OR6C68
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 68
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403284 (OR6C68)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403284 (OR6C68)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 ECSCR
Motif
Other DBs
NCBI-GeneID: 403284
NCBI-ProteinID: NP_001005519
HGNC: 31297
Ensembl: ENSG00000205327
Vega: OTTHUMG00000169958
Pharos: A6NDL8(Tdark)
UniProt: A6NDL8
Position
12q13.2
AA seq 312 aa AA seqDB search
MRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIALTMLDPHLKTPMYFF
LQNLSFLEISFTATCVPRFLYSISTGNKIITYNACVIQLFFADLFGVTEFFLLATMSYDR
YVAICKPLHYMAIMSNKVCKTMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDAL
PILKIPCSDTSLIEQMVVASAVLTFIITLVCVVLSYTYIIRTILKFPSVQQKKKAFSTCS
SHITVVSITYGSCIFIYIKPSAKEEVNINKGVSVLISSISPMLNSFIYTLRNEQVKQAFH
DSLKKIAFRLKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacacacagcaataacaacattcatccttctgggactgacagaagatcctcag
ctgcaggttctgcttttcatgtttctatttatcacctacatgttgagtgtaacagggaaa
ctgaccattatcgccctcaccatgttggatccccacctgaaaacacccatgtattttttt
ctccaaaatttatctttcttagaaatctcatttacagctacctgtgttccaagattctta
tacagtatctcaactgggaacaaaataataacgtataatgcatgtgtcattcagctattt
tttgcagacctctttggggtaactgaattttttcttttggctaccatgtcatatgatcgc
tatgtggccatctgcaaacccttgcattatatggcaatcatgagcaacaaagtgtgcaaa
acaatggttatttgttgttggatggcagcacttatgattatcctcccaccacttagctta
ggttttcatctagaattctgtgactctaatgtcatcaatcattttggctgtgatgcattg
cctattctgaaaataccatgctcagacacatcattaattgagcagatggttgtagcctct
gctgtattaacctttattatcactcttgtatgtgtagttctgtcctacacatatatcata
agaacaattctaaaattcccttctgttcaacaaaagaaaaaagccttttctacctgttct
tcacatattactgtggtttccatcacttatggcagctgcatcttcatctatatcaagcca
tctgcaaaagaagaggtaaacattaataaaggtgtgtcagtgcttatttcatccatatca
cctatgttgaattctttcatatatactcttaggaatgagcaagttaaacaagcctttcat
gactcactcaaaaaaattgcatttcgtttaaaaaagtaa

DBGET integrated database retrieval system