KEGG   Homo sapiens (human): 4036Help
Entry
4036              CDS       T01001                                 

Gene name
LRP2, DBS, GP330
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  
low density lipoprotein-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Hedgehog signaling pathway
Thyroid hormone synthesis
Disease
H00886  
Donnai-Barrow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    4036 (LRP2)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    4036 (LRP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    4036 (LRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P98164(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.1
AA seq 4655 aa AA seqDB search
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQMINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGVDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCASGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKR
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPKDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMSEDFVMEMGKQPIIFENPMYSARDSAVKVVQPIQVTVSENVDNKNYGSPINPSE
IVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQMENEQKESVAATPPPSPSLP
AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
NT seq 13968 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcgggccggcagcagtggcgtgcacgctgctcctggctctcgtcgcctgccta
gcgccggccagtggccaagaatgtgacagtgcgcattttcgctgtggaagtgggcattgc
atccctgcagactggaggtgtgatgggaccaaagactgttcagatgacgcggatgaaatt
ggctgcgctgttgtgacctgccagcagggctatttcaagtgccagagtgagggacaatgc
atccccaactcctgggtgtgtgaccaagatcaagactgtgatgatggctcagatgaacgt
caagattgctcacaaagtacatgctcaagtcatcagataacatgctccaatggtcagtgt
atcccaagtgaatacaggtgcgaccacgtcagagactgccccgatggagctgatgagaat
gactgccagtacccaacatgtgagcagcttacttgtgacaatggggcctgctataacacc
agtcagaagtgtgattggaaagttgattgcagggactcctcagatgaaatcaactgcact
gagatatgcttgcacaatgagttttcatgtggcaatggagagtgtatccctcgtgcttat
gtctgtgaccatgacaatgattgccaagacggcagtgacgaacatgcttgcaactatccg
acctgcggtggttaccagttcacttgccccagtggccgatgcatttatcaaaactgggtt
tgtgatggagaagatgactgtaaagataatggagatgaagatggatgtgaaagcggtcct
catgatgttcataaatgttccccaagagaatggtcttgcccagagtcgggacgatgcatc
tccatttataaagtttgtgatgggattttagattgcccaggaagagaagatgaaaacaac
actagtaccggaaaatactgtagtatgactctgtgctctgccttgaactgccagtaccag
tgccatgagacgccgtatggaggagcgtgtttttgtcccccaggttatatcatcaaccac
aatgacagccgtacctgtgttgagtttgatgattgccagatatggggaatttgtgaccag
aagtgtgaaagccgacctggccgtcacctgtgccactgtgaagaagggtatatcttggag
cgtggacagtattgcaaagctaatgattcctttggcgaggcctccattatcttctccaat
ggtcgggatttgttaattggtgatattcatggaaggagcttccggatcctagtggagtct
cagaatcgtggagtggccgtgggtgtggctttccactatcacctgcaaagagttttttgg
acagacaccgtgcaaaataaggttttttcagttgacattaatggtttaaatatccaagag
gttctcaatgtttctgttgaaaccccagagaacctggctgtggactgggttaataataaa
atctatctagtggaaaccaaggtcaaccgcatagatatggtaaatttggatggaagctat
cgggttacccttataactgaaaacttggggcatcctagaggaattgccgtggacccaact
gttggttatttatttttctcagattgggagagcctttctggggaacctaagctggaaagg
gcattcatggatggcagcaaccgtaaagacttggtgaaaacaaagctgggatggcctgct
ggggtaactctggatatgatatcgaagcgtgtttactgggttgactctcggtttgattac
attgaaactgtaacttatgatggaattcaaaggaagactgtagttcatggaggctccctc
attcctcatccctttggagtaagcttatttgaaggtcaggtgttctttacagattggaca
aagatggccgtgctgaaggcaaacaagttcacagagaccaacccacaagtgtactaccag
gcttccctgaggccctatggagtgactgtttaccattccctcagacagccctatgctacc
aatccgtgtaaagataacaatgggggctgtgagcaggtctgtgtcctcagccacagaaca
gataatgatggtttgggtttccgttgcaagtgcacattcggcttccaactggatacagat
gagcgccactgcattgctgttcagaatttcctcattttttcatcccaagttgctattcgt
gggatcccgttcaccttgtctacccaggaagatgtcatggttccagtttcggggaatcct
tctttctttgtcgggattgattttgacgcccaggacagcactatctttttttcagatatg
tcaaaacacatgatttttaagcaaaagattgatggcacaggaagagaaattctcgcagct
aacagggtggaaaatgttgaaagtttggcttttgattggatttcaaagaatctctattgg
acagactctcattacaagagtatcagtgtcatgaggctagctgataaaacgagacgcaca
gtagttcagtatttaaataacccacggtcggtggtagttcatccttttgccgggtatcta
ttcttcactgattggttccgtcctgctaaaattatgagagcatggagtgacggatctcac
ctcttgcctgtaataaacactactcttggatggcccaatggcttggccatcgattgggct
gcttcacgattgtactgggtagatgcctattttgataaaattgagcacagcacctttgat
ggtttagacagaagaagactgggccatatagagcagatgacacatccgtttggacttgcc
atctttggagagcatttattttttactgactggagactgggtgccattattcgagtcagg
aaagcagatggtggagaaatgacagttatccgaagtggcattgcttacatactgcatttg
aaatcgtatgatgtcaacatccagactggttctaacgcctgtaatcaacccacgcatcct
aacggtgactgcagccacttctgcttcccggtgccaaatttccagcgagtgtgtgggtgc
ccttatggaatgaggctggcttccaatcacttgacatgcgagggggacccaaccaatgaa
ccacccacagagcagtgtggcttattttccttcccctgtaaaaatggcagatgtgtgccc
aattactatctctgtgatggagtcgatgattgtcatgataacagtgatgagcaactatgt
ggcacacttaataatacctgttcatcttcggcgttcacctgtggccatggggagtgcatt
cctgcacactggcgctgtgacaaacgcaacgactgtgtggatggcagtgatgagcacaac
tgccccacccacgcacctgcttcctgccttgacacccaatacacctgtgataatcaccag
tgtatctcaaagaactgggtctgtgacacagacaatgattgtggggatggatctgatgaa
aagaactgcaattcgacagagacatgccaacctagtcagtttaattgccccaatcatcga
tgtattgacctatcgtttgtctgtgatggtgacaaggattgtgttgatggatctgatgag
gttggttgtgtattaaactgtactgcttctcaattcaagtgtgccagtggggataaatgt
attggcgtcacaaatcgttgtgatggtgtttttgattgcagtgacaactcggatgaagca
ggctgtccaaccaggcctcctggtatgtgccactcagatgaatttcagtgccaagaagat
ggtatctgcatcccgaacttctgggaatgtgatgggcatccagactgcctctatggatct
gatgagcacaatgcctgtgtccccaagacttgcccttcatcatatttccactgtgacaac
ggaaactgcatccacagggcatggctctgtgatcgggacaatgactgcggggatatgagt
gatgagaaggactgccctactcagccctttcgctgtcctagttggcaatggcagtgtctt
ggccataacatctgtgtgaatctgagtgtagtgtgtgatggcatctttgactgccccaat
gggacagatgagtccccactttgcaatgggaacagctgctcagatttcaatggtggttgt
actcacgagtgtgttcaagagccctttggggctaaatgcctatgtccattgggattctta
cttgccaatgattctaagacctgtgaagacatagatgaatgtgatattctaggctcttgt
agccagcactgttacaatatgagaggttctttccggtgctcgtgtgatacaggctacatg
ttagaaagtgatgggaggacttgcaaagttacagcatctgagagtctgctgttacttgtg
gcaagtcagaacaaaattattgccgacagtgtcacctcccaggtccacaatatctattca
ttggtcgagaatggttcttacattgtagctgttgattttgattcaattagtggtcgtatc
ttttggtctgatgcaactcagggtaaaacctggagtgcgtttcaaaatggaacggacaga
agagtggtatttgacagtagcatcatcttgactgaaactattgcaatagattgggtaggt
cgtaatctttactggacagactatgctctggaaacaattgaagtctccaaaattgatggg
agccacaggactgtgctgattagtaaaaacctaacaaatccaagaggactagcattagat
cccagaatgaatgagcatctactgttctggtctgactggggccaccaccctcgcatcgag
cgagccagcatggacggcagcatgcgcactgtcattgtccaggacaagatcttctggccc
tgcggcttaactattgactaccccaacagactgctctacttcatggactcctatcttgat
tacatggacttttgtgattataatggacaccatcggagacaggtgatagccagtgatttg
attatacggcacccctatgccctaactctctttgaagactctgtgtactggactgaccgt
gctactcgtcgggttatgcgagccaacaagtggcatggagggaaccagtcagttgtaatg
tataatattcaatggccccttgggattgttgcggttcatccttcgaaacaaccaaattcc
gtgaatccatgtgccttttcccgctgcagccatctctgcctgctttcctcacaggggcct
catttttactcctgtgtttgtccttcaggatggagtctgtctcctgatctcctgaattgc
ttgagagatgatcaacctttcttaataactgtaaggcaacatataatttttggaatctcc
cttaatcctgaggtgaagagcaatgatgctatggtccccatagcagggatacagaatggt
ttagatgttgaatttgatgatgctgagcaatacatctattgggttgaaaatccaggtgaa
attcacagagtgaagacagatggcaccaacaggacagtatttgcttctatatctatggtg
gggccttctatgaacctggccttagattggatttcaagaaacctttattctaccaatcct
agaactcagtcaatcgaggttttgacactccacggagatatcagatacagaaaaacattg
attgccaatgatgggacagctcttggagttggctttccaattggcataactgttgatcct
gctcgtgggaagctgtactggtcagaccaaggaactgacagtggggttcctgccaagatc
gccagtgctaacatggatggcacatctgtgaaaactctctttactgggaacctcgaacac
ctggagtgtgtcactcttgacatcgaagagcagaaactctactgggcagtcactggaaga
ggagtgattgaaagaggaaacgtggatggaacagatcgaatgatcctggtacaccagctt
tcccacccctggggaattgcagtccatgattctttcctttattatactgatgaacagtat
gaggtcattgaaagagttgataaggccactggggccaacaaaatagtcttgagagataat
gttccaaatctgaggggtcttcaagtttatcacagacgcaatgccgccgaatcctcaaat
ggctgtagcaacaacatgaatgcctgtcagcagatttgcctgcctgtaccaggaggattg
ttttcctgcgcctgtgccactggatttaaactcaatcctgataatcggtcctgctctcca
tataactctttcattgttgtttcaatgctgtctgcaatcagaggctttagcttggaattg
tcagatcattcagaaaccatggtgccggtggcaggccaaggacgaaacgcactgcatgtg
gatgtggatgtgtcctctggctttatttattggtgtgattttagcagctcagtggcatct
gataatgcgatccgtagaattaaaccagatggatcttctctgatgaacattgtgacacat
ggaataggagaaaatggagtccggggtattgcagtggattgggtagcaggaaatctttat
ttcaccaatgcctttgtttctgaaacactgatagaagttctgcggatcaatactacttac
cgccgtgttcttcttaaagtcacagtggacatgcctaggcatattgttgtagatcccaag
aacagatacctcttctgggctgactatgggcagagaccaaagattgagcgttctttcctt
gactgtaccaatcgaacagtgcttgtgtcagagggcattgtcacaccacggggcttggca
gtggaccgaagtgatggctacgtttattgggttgatgattctttagatataattgcaagg
attcgtatcaatggagagaactctgaagtgattcgttatggcagtcgttacccaactcct
tatggcatcactgtttttgaaaattctatcatatgggtagataggaatttgaaaaagatc
ttccaagccagcaaggaaccagagaacacagagccacccacagtgataagagacaatatc
aactggctaagagatgtgaccatctttgacaagcaagtccagccccggtcaccagcagag
gtcaacaacaacccttgcttggaaaacaatggtgggtgctctcatctctgctttgctctg
cctggattgcacaccccaaaatgtgactgtgcctttgggaccctgcaaagtgatggcaag
aattgtgccatttcaacagaaaatttcctcatctttgccttgtctaattccttgagaagc
ttacacttggaccctgaaaaccatagcccacctttccaaacaataaatgtggaaagaact
gtcatgtctctagactatgacagtgtaagtgatagaatctacttcacacaaaatttagcc
tctggagttggacagatttcctatgccaccctgtcttcagggatccatactccaactgtc
attgcttcaggtatagggactgctgatggcattgcctttgactggattactagaagaatt
tattacagtgactacctcaaccagatgattaattccatggctgaagatgggtctaaccgc
actgtgatagcccgcgttccaaaaccaagagcaattgtgttagatccctgccaagggtac
ctgtactgggctgactgggatacacatgccaaaatcgagagagccacattgggaggaaac
ttccgcgtacccattgtgaacagcagtctggtcatgcccagtgggctgactctggactat
gaagaggaccttctctactgggtggatgctagtctgcagaggattgaacgcagcactctg
acgggcgtggatcgtgaagtcattgtcaatgcagccgttcatgcttttggcttgactctc
tatggccagtatatttactggactgacttgtacacacaaagaatttaccgagctaacaaa
tatgacgggtcaggtcagattgcaatgaccacaaatttgctctcccagcccaggggaatc
aacactgttgtgaagaaccagaaacaacagtgtaacaatccttgtgaacagtttaatggg
ggctgcagccatatctgtgcaccaggtccaaatggtgccgagtgccagtgtccacatgag
ggcaactggtatttggccaacaacaggaagcactgcattgtggacaatggtgaacgatgt
ggtgcatcttccttcacctgctccaatgggcgctgcatctcggaagagtggaagtgtgat
aatgacaacgactgtggggatggcagtgatgagatggaaagtgtctgtgcacttcacacc
tgctcaccgacagccttcacctgtgccaatgggcgatgtgtccaatactcttaccgctgt
gattactacaatgactgtggtgatggcagtgatgaggcagggtgcctgttcagggactgc
aatgccaccacggagtttatgtgcaataacagaaggtgcatacctcgtgagtttatctgc
aatggtgtagacaactgccatgataataacacttcagatgagaaaaattgccctgatcgc
acttgccagtctggatacacaaaatgtcataattcaaatatttgtattcctcgcgtttat
ttgtgtgacggagacaatgactgtggagataacagtgatgaaaaccctacttattgcacc
actcacacgtgcagcagcagtgagttccaatgcgcatctgggcgctgtattcctcaacat
tggtattgtgatcaagaaacagattgttttgatgcctctgatgaacctgcctcttgtggt
cactctgagcgaacatgcctagctgatgagttcaagtgtgatggtgggaggtgcatccca
agcgaatggatctgtgacggtgataatgactgtggggatatgagtgacgaggataaaagg
caccagtgtcagaatcaaaactgctcggattccgagtttctctgtgtaaatgacagacct
ccggacaggaggtgcattccccagtcttgggtctgtgatggcgatgtggattgtactgac
ggctacgatgagaatcagaattgcaccaggagaacttgctctgaaaatgaattcacctgt
ggttacggactgtgtatcccaaagatattcaggtgtgaccggcacaatgactgtggtgac
tatagcgacgagaggggctgcttataccagacttgccaacagaatcagtttacctgtcag
aacgggcgctgcattagtaaaaccttcgtctgtgatgaggataatgactgtggagacgga
tctgatgagctgatgcacctgtgccacaccccagaacccacgtgtccacctcacgagttc
aagtgtgacaatgggcgctgcatcgagatgatgaaactctgcaaccacctagatgactgt
ttggacaacagcgatgagaaaggctgtggcattaatgaatgccatgacccttcaatcagt
ggctgcgatcacaactgcacagacaccttaaccagtttctattgttcctgtcgtcctggt
tacaagctcatgtctgacaagcggacttgtgttgatattgatgaatgcacagagatgcct
tttgtctgtagccagaagtgtgagaatgtaataggctcctacatctgtaagtgtgcccca
ggctacctccgagaaccagatggaaagacctgccggcaaaacagtaacatcgaaccctat
ctcatttttagcaaccgttactatttgagaaatttaactatagatggctatttttactcc
ctcatcttggaaggactggacaatgttgtggcattagattttgaccgagtagagaagaga
ttgtattggattgatacacagaggcaagtcattgagagaatgtttctgaataagacaaac
aaggagacaatcataaaccacagactaccagctgcagaaagtctggctgtagactgggtt
tccagaaagctctactggttggatgcccgcctggatggcctctttgtctctgacctcaat
ggtggacaccgccgcatgctggcccagcactgtgtggatgccaacaacaccttctgcttt
gataatcccagaggacttgcccttcaccctcaatatgggtacctctactgggcagactgg
ggtcaccgcgcatacattgggagagtaggcatggatggaaccaacaagtctgtgataatc
tccaccaagttagagtggcctaatggcatcaccattgattacaccaatgatctactctac
tgggcagatgcccacctgggttacatagagtactctgatttggagggccaccatcgacac
acggtgtatgatggggcactgcctcaccctttcgctattaccatttttgaagacactatt
tattggacagattggaatacaaggacagtggaaaagggaaacaaatatgatggatcaaat
agacagacactggtgaacacaacacacagaccatttgacatccatgtgtaccatccatat
aggcagcccattgtgagcaatccctgtggtaccaacaatggtggctgttctcatctctgc
ctcatcaagccaggaggaaaagggttcacttgcgagtgtccagatgacttccgcaccctt
cagctgagtggcagcacctactgcatgcccatgtgctccagcacccagttcctgtgcgct
aacaatgaaaagtgcattcctatctggtggaaatgtgatggacagaaagactgctcagat
ggctctgatgaactggccctttgcccgcagcgcttctgccgactgggacagttccagtgc
agtgacggcaactgcaccagcccgcagactttatgcaatgctcaccaaaattgccctgat
gggtctgatgaagaccgtcttctttgtgagaatcaccactgtgactccaatgaatggcag
tgcgccaacaaacgttgcatcccagaatcctggcagtgtgacacatttaacgactgtgag
gataactcagatgaagacagttcccactgtgccagcaggacctgccggccgggccagttt
cggtgtgctaatggccgctgcatcccgcaggcctggaagtgtgatgtggataatgattgt
ggagaccactcggatgagcccattgaagaatgcatgagctctgcccatctctgtgacaac
ttcacagaattcagctgcaaaacaaattaccgctgcatcccaaagtgggccgtgtgcaat
ggtgtagatgactgcagggacaacagtgatgagcaaggctgtgaggagaggacatgccat
cctgtgggggatttccgctgtaaaaatcaccactgcatccctcttcgttggcagtgtgat
gggcaaaatgactgtggagataactcagatgaggaaaactgtgctccccgggagtgcaca
gagagcgagtttcgatgtgtcaatcagcagtgcattccctcgcgatggatctgtgaccat
tacaacgactgtggggacaactcagatgaacgggactgtgagatgaggacctgccatcct
gaatattttcagtgtacaagtggacattgtgtacacagtgaactgaaatgcgatggatcc
gctgactgtttggatgcgtctgatgaagctgattgtcccacacgctttcctgatggtgca
tactgccaggctactatgttcgaatgcaaaaaccatgtttgtatcccgccatattggaaa
tgtgatggcgatgatgactgtggcgatggttcagatgaagaacttcacctgtgcttggat
gttccctgtaattcaccaaaccgtttccggtgtgacaacaatcgctgcatttatagtcat
gaggtgtgcaatggtgtggatgactgtggagatggaactgatgagacagaggagcactgt
agaaaaccgacccctaaaccttgtacagaatatgaatataagtgtggcaatgggcattgc
attccacatgacaatgtgtgtgatgatgccgatgactgtggtgactggtccgatgaactg
ggttgcaataaaggaaaagaaagaacatgtgctgaaaatatatgcgagcaaaattgtacc
caattaaatgaaggaggatttatctgctcctgtacagctgggttcgaaaccaatgttttt
gacagaacctcctgtctagatatcaatgaatgtgaacaatttgggacttgtccccagcac
tgcagaaataccaaaggaagttatgagtgtgtctgtgctgatggcttcacgtctatgagt
gaccgccctggaaaacgatgtgcagctgagggtagctctcctttgttgctactgcctgac
aatgtccgaattcgaaaatataatctctcatctgagaggttctcagagtatcttcaagat
gaggaatatatccaagctgttgattatgattgggatcccaaggacataggcctcagtgtt
gtgtattacactgtgcgaggggagggctctaggtttggtgctatcaaacgtgcctacatc
cccaactttgaatccggccgcaataatcttgtgcaggaagttgacctgaaactgaaatac
gtaatgcagccagatggaatagcagtggactgggttggaaggcatatttactggtcagat
gtcaagaataaacgcattgaggtggctaaacttgatggaaggtacagaaagtggctgatt
tccactgacctggaccaaccagctgctattgctgtgaatcccaaactagggcttatgttc
tggactgactggggaaaggaacctaaaatcgagtctgcctggatgaatggagaggaccgc
aacatcctggttttcgaggaccttggttggccaactggcctttctatcgattatttgaac
aatgaccgaatctactggagtgacttcaaggaggacgttattgaaaccataaaatatgat
gggactgataggagagtcattgcaaaggaagcaatgaacccttacagcctggacatcttt
gaagaccagttatactggatatctaaggaaaagggagaagtatggaaacaaaataaattt
gggcaaggaaagaaagagaaaacgctggtagtgaacccttggctcactcaagttcgaatc
tttcatcaactcagatacaataagtcagtgcccaacctttgcaaacagatctgcagccac
ctctgccttctgagacctggaggatacagctgtgcctgtccccaaggctccagctttata
gaggggagcaccactgagtgtgatgcagccatcgaactgcctatcaacctgcccccccca
tgcaggtgcatgcacggaggaaattgctattttgatgagactgacctccccaaatgcaag
tgtcctagcggctacaccggaaaatattgtgaaatggcgttttcaaaaggcatctctcca
ggaacaaccgcagtagctgtgctgttgacaatcctcttgatcgtcgtaattggagctctg
gcaattgcaggattcttccactatagaaggaccggctcccttttgcctgctctgcccaag
ctgccaagcttaagcagtctcgtcaagccctctgaaaatgggaatggggtgaccttcaga
tcaggggcagatcttaacatggatattggagtgtctggttttggacctgagactgctatt
gacaggtcaatggcaatgagtgaagactttgtcatggaaatggggaagcagcccataata
tttgaaaacccaatgtactcagccagagacagtgctgtcaaagtggttcagccaatccag
gtgactgtatctgaaaatgtggataataagaattatggaagtcccataaacccttctgag
atagttccagagacaaacccaacttcaccagctgctgatggaactcaggtgacaaaatgg
aatctcttcaaacgaaaatctaaacaaactaccaactttgaaaatccaatctatgcacag
atggagaacgagcaaaaggaaagtgttgctgcgacaccacctccatcaccttcgctccct
gctaagcctaagcctccttcgagaagagacccaactccaacctattctgcaacagaagac
acttttaaagacaccgcaaatcttgttaaagaagactctgaagtatag

DBGET integrated database retrieval system