KEGG   Homo sapiens (human): 4041Help
Entry
4041              CDS       T01001                                 

Gene name
LRP5, BMND1, EVR1, EVR4, HBM, LR3, LRP-5, LRP7, OPPG, OPS, OPTA1, VBCH2
Definition
low density lipoprotein receptor-related protein 5
Orthology
K03068  
low density lipoprotein receptor-related protein 5/6
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Disease
H00436  
Osteopetrosis
H00450  
Sclerosing bone dysplasias
H00451  
Osteoporosis-pseudoglioma syndrome (OPPG)
H00589  
Familial exudative vitreoretinopathy (FEVR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4041 (LRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 1034 aa AA seqDB search
MKDERTEDVMLAAALPAVLGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCI
VPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISR
AFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLD
NPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWT
DLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTL
IQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNC
SPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIK
RAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVV
LRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDN
TLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVE
KTTGDKRTRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCP
VHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAA
QFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDC
IDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGP
FPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGA
SSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTT
PCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYF
HLFPPPPSPCTDSS
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgagaggacagaggacgtgatgcttgctgctgcattgcctgcagtcctggga
accaacccgtgtgcggacaggaacggggggtgcagccacctgtgcttcttcacaccccac
gcaacccggtgtggctgccccatcggcctggagctgctgagtgacatgaagacctgcatc
gtgcctgaggccttcttggtcttcaccagcagagccgccatccacaggatctccctcgag
accaataacaacgacgtggccatcccgctcacgggcgtcaaggaggcctcagccctggac
tttgatgtgtccaacaaccacatctactggacagacgtcagcctgaagaccatcagccgc
gccttcatgaacgggagctcggtggagcacgtggtggagtttggccttgactaccccgag
ggcatggccgttgactggatgggcaagaacctctactgggccgacactgggaccaacaga
atcgaagtggcgcggctggacgggcagttccggcaagtcctcgtgtggagggacttggac
aacccgaggtcgctggccctggatcccaccaagggctacatctactggaccgagtggggc
ggcaagccgaggatcgtgcgggccttcatggacgggaccaactgcatgacgctggtggac
aaggtgggccgggccaacgacctcaccattgactacgctgaccagcgcctctactggacc
gacctggacaccaacatgatcgagtcgtccaacatgctgggtcaggagcgggtcgtgatt
gccgacgatctcccgcacccgttcggtctgacgcagtacagcgattatatctactggaca
gactggaatctgcacagcattgagcgggccgacaagactagcggccggaaccgcaccctc
atccagggccacctggacttcgtgatggacatcctggtgttccactcctcccgccaggat
ggcctcaatgactgtatgcacaacaacgggcagtgtgggcagctgtgccttgccatcccc
ggcggccaccgctgcggctgcgcctcacactacaccctggaccccagcagccgcaactgc
agcccgcccaccaccttcttgctgttcagccagaaatctgccatcagtcggatgatcccg
gacgaccagcacagcccggatctcatcctgcccctgcatggactgaggaacgtcaaagcc
atcgactatgacccactggacaagttcatctactgggtggatgggcgccagaacatcaag
cgagccaaggacgacgggacccagccctttgttttgacctctctgagccaaggccaaaac
ccagacaggcagccccacgacctcagcatcgacatctacagccggacactgttctggacg
tgcgaggccaccaataccatcaacgtccacaggctgagcggggaagccatgggggtggtg
ctgcgtggggaccgcgacaagcccagggccatcgtcgtcaacgcggagcgagggtacctg
tacttcaccaacatgcaggaccgggcagccaagatcgaacgcgcagccctggacggcacc
gagcgcgaggtcctcttcaccaccggcctcatccgccctgtggccctggtggtggacaac
acactgggcaagctgttctgggtggacgcggacctgaagcgcattgagagctgtgacctg
tcaggggccaaccgcctgaccctggaggacgccaacatcgtgcagcctctgggcctgacc
atccttggcaagcatctctactggatcgaccgccagcagcagatgatcgagcgtgtggag
aagaccaccggggacaagcggactcgcatccagggccgtgtcgcccacctcactggcatc
catgcagtggaggaagtcagcctggaggagttctcagcccacccatgtgcccgtgacaat
ggtggctgctcccacatctgtattgccaagggtgatgggacaccacggtgctcatgccca
gtccacctcgtgctcctgcagaacctgctgacctgtggagagccgcccacctgctccccg
gaccagtttgcatgtgccacaggggagatcgactgtatccccggggcctggcgctgtgac
ggctttcccgagtgcgatgaccagagcgacgaggagggctgccccgtgtgctccgccgcc
cagttcccctgcgcgcggggtcagtgtgtggacctgcgcctgcgctgcgacggcgaggca
gactgtcaggaccgctcagacgaggcggactgtgacgccatctgcctgcccaaccagttc
cggtgtgcgagcggccagtgtgtcctcatcaaacagcagtgcgactccttccccgactgt
atcgacggctccgacgagctcatgtgtgaaatcaccaagccgccctcagacgacagcccg
gcccacagcagtgccatcgggcccgtcattggcatcatcctctctctcttcgtcatgggt
ggtgtctattttgtgtgccagcgcgtggtgtgccagcgctatgcgggggccaacgggccc
ttcccgcacgagtatgtcagcgggaccccgcacgtgcccctcaatttcatagccccgggc
ggttcccagcatggccccttcacaggcatcgcatgcggaaagtccatgatgagctccgtg
agcctgatggggggccggggcggggtgcccctctacgaccggaaccacgtcacaggggcc
tcgtccagcagctcgtccagcacgaaggccacgctgtacccgccgatcctgaacccgccg
ccctccccggccacggacccctccctgtacaacatggacatgttctactcttcaaacatt
ccggccactgcgagaccgtacaggccctacatcattcgaggaatggcgcccccgacgacg
ccctgcagcaccgacgtgtgtgacagcgactacagcgccagccgctggaaggccagcaag
tactacctggatttgaactcggactcagacccctatccacccccacccacgccccacagc
cagtacctgtcggcggaggacagctgcccgccctcgcccgccaccgagaggagctacttc
catctcttcccgccccctccgtccccctgcacggactcatcctga

DBGET integrated database retrieval system