KEGG   Homo sapiens (human): 4048Help
Entry
4048              CDS       T01001                                 

Gene name
LTA4H
Definition
(RefSeq) leukotriene A4 hydrolase (EC:3.3.2.6)
  KO
K01254  
leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    4048 (LTA4H)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     4048 (LTA4H)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   4048 (LTA4H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q22
AA seq 611 aa AA seqDB search
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatagtggatacctgttcgttggcctctccggcttccgtctgccggaccaag
cacctgcacctgcgctgcagcgtcgactttactcgccggacgctgaccgggactgctgct
ctcacggtccagtctcaggaggacaatctgcgcagcctggttttggatacaaaggacctt
acaatagaaaaagtagtgatcaatggacaagaagtcaaatatgctcttggagaaagacaa
agttacaagggatcgccaatggaaatctctcttcctatcgctttgagcaaaaatcaagaa
attgttatagaaatttcttttgagacctctccaaaatcttctgctctccagtggctcact
cctgaacagacttctgggaaggaacacccatatctctttagtcagtgccaggccatccac
tgcagagcaatccttccttgtcaggacactccttctgtgaaattaacctatactgcagag
gtgtctgtccctaaagaactggtggcacttatgagtgctattcgtgatggagaaacacct
gacccagaagacccaagcaggaaaatatacaaattcatccaaaaagttccaataccctgc
tacctgattgctttagttgttggagctttagaaagcaggcaaattggcccaagaactttg
gtgtggtctgagaaagagcaggtggaaaagtctgcttatgagttttctgagactgaatct
atgcttaaaatagcagaagatctgggaggaccgtatgtatggggacagtatgacctattg
gtcctgccaccatccttcccttatggtggcatggagaatccttgccttacttttgtaact
cctactctactggcaggcgacaagtcactctccaatgtcattgcacatgaaatatctcat
agctggacagggaatctagtgaccaacaaaacttgggatcacttttggttaaatgaggga
catactgtgtacttggaacgccacatttgcggacgattgtttggtgaaaagttcagacat
tttaatgctctgggaggatggggagaactacagaattcggtaaagacatttggggagaca
catcctttcaccaaacttgtggttgatctgacagatatagaccctgatgtagcttattct
tcagttccctatgagaagggctttgctttacttttttaccttgaacaactgcttggagga
ccagagattttcctaggattcttaaaagcttatgttgagaagttttcctataagagcata
actactgatgactggaaggatttcctgtattcctattttaaagataaggttgatgttctc
aatcaagttgattggaatgcctggctctactctcctggactgcctcccataaagcccaat
tatgatatgactctgacaaatgcttgtattgccttaagtcaaagatggattactgccaaa
gaagatgatttaaattcattcaatgccacagacctgaaggatctctcttctcatcaattg
aatgagtttttagcacagacgctccagagggcacctcttccattggggcacataaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggctg
cggctctgcattcaatccaagtgggaggacgcaattcctttggcgctaaagatggcaact
gaacaaggaagaatgaagtttacccggcccttattcaaggatcttgctgcctttgacaaa
tcccatgatcaagctgtccgaacctaccaagagcacaaagcaagcatgcatcccgtgact
gcaatgctggtggggaaagacttaaaagtggattaa

DBGET integrated database retrieval system