KEGG   Homo sapiens (human): 4048Help
Entry
4048              CDS       T01001                                 

Gene name
LTA4H
Definition
(RefSeq) leukotriene A4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    4048 (LTA4H)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     4048 (LTA4H)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   4048 (LTA4H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C E1_DerP2_DerF2 Peptidase_M48
Motif
Other DBs
NCBI-GeneID: 4048
NCBI-ProteinID: NP_000886
OMIM: 151570
HGNC: 6710
Ensembl: ENSG00000111144
Vega: OTTHUMG00000170355
Pharos: P09960(Tchem)
UniProt: P09960 A0A140VK27
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 611 aa AA seqDB search
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatagtggatacctgttcgttggcctctccggcttccgtctgccggaccaag
cacctgcacctgcgctgcagcgtcgactttactcgccggacgctgaccgggactgctgct
ctcacggtccagtctcaggaggacaatctgcgcagcctggttttggatacaaaggacctt
acaatagaaaaagtagtgatcaatggacaagaagtcaaatatgctcttggagaaagacaa
agttacaagggatcgccaatggaaatctctcttcctatcgctttgagcaaaaatcaagaa
attgttatagaaatttcttttgagacctctccaaaatcttctgctctccagtggctcact
cctgaacagacttctgggaaggaacacccatatctctttagtcagtgccaggccatccac
tgcagagcaatccttccttgtcaggacactccttctgtgaaattaacctatactgcagag
gtgtctgtccctaaagaactggtggcacttatgagtgctattcgtgatggagaaacacct
gacccagaagacccaagcaggaaaatatacaaattcatccaaaaagttccaataccctgc
tacctgattgctttagttgttggagctttagaaagcaggcaaattggcccaagaactttg
gtgtggtctgagaaagagcaggtggaaaagtctgcttatgagttttctgagactgaatct
atgcttaaaatagcagaagatctgggaggaccgtatgtatggggacagtatgacctattg
gtcctgccaccatccttcccttatggtggcatggagaatccttgccttacttttgtaact
cctactctactggcaggcgacaagtcactctccaatgtcattgcacatgaaatatctcat
agctggacagggaatctagtgaccaacaaaacttgggatcacttttggttaaatgaggga
catactgtgtacttggaacgccacatttgcggacgattgtttggtgaaaagttcagacat
tttaatgctctgggaggatggggagaactacagaattcggtaaagacatttggggagaca
catcctttcaccaaacttgtggttgatctgacagatatagaccctgatgtagcttattct
tcagttccctatgagaagggctttgctttacttttttaccttgaacaactgcttggagga
ccagagattttcctaggattcttaaaagcttatgttgagaagttttcctataagagcata
actactgatgactggaaggatttcctgtattcctattttaaagataaggttgatgttctc
aatcaagttgattggaatgcctggctctactctcctggactgcctcccataaagcccaat
tatgatatgactctgacaaatgcttgtattgccttaagtcaaagatggattactgccaaa
gaagatgatttaaattcattcaatgccacagacctgaaggatctctcttctcatcaattg
aatgagtttttagcacagacgctccagagggcacctcttccattggggcacataaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggctg
cggctctgcattcaatccaagtgggaggacgcaattcctttggcgctaaagatggcaact
gaacaaggaagaatgaagtttacccggcccttattcaaggatcttgctgcctttgacaaa
tcccatgatcaagctgtccgaacctaccaagagcacaaagcaagcatgcatcccgtgact
gcaatgctggtggggaaagacttaaaagtggattaa

DBGET integrated database retrieval system