KEGG   Homo sapiens (human): 4050Help
Entry
4050              CDS       T01001                                 

Gene name
LTB, TNFC, TNFSF3, p33
Definition
lymphotoxin beta (TNF superfamily, member 3)
Orthology
K03157  
lymphotoxin beta (TNF superfamily, member 3)
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Rheumatoid arthritis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4050 (LTB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4050 (LTB)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    4050 (LTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 244 aa AA seqDB search
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETAD
PGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFS
DAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggggcactggggctggagggcaggggtgggaggctccaggggaggggttccctcctg
ctagctgtggcaggagccacttctctggtgaccttgttgctggcggtgcctatcactgtc
ctggctgtgctggccttagtgccccaggatcagggaggactggtaacggagacggccgac
cccggggcacaggcccagcaaggactggggtttcagaagctgccagaggaggagccagaa
acagatctcagccccgggctcccagctgcccacctcataggcgctccgctgaaggggcag
gggctaggctgggagacgacgaaggaacaggcgtttctgacgagcgggacgcagttctcg
gacgccgaggggctggcgctcccgcaggacggcctctattacctctactgtctcgtcggc
taccggggccgggcgccccctggcggcggggacccccagggccgctcggtcacgctgcgc
agctctctgtaccgggcggggggcgcctacgggccgggcactcccgagctgctgctcgag
ggcgccgagacggtgactccagtgctggacccggccaggagacaagggtacgggcctctc
tggtacacgagcgtggggttcggcggcctggtgcagctccggaggggcgagagggtgtac
gtcaacatcagtcaccccgatatggtggacttcgcgagagggaagaccttctttggggcc
gtgatggtggggtga

DBGET integrated database retrieval system