KEGG   Homo sapiens (human): 4053Help
Entry
4053              CDS       T01001                                 

Gene name
LTBP2, C14orf141, GLC3D, LTBP3, MSPKA, MSTP031, WMS3
Definition
(RefSeq) latent transforming growth factor beta binding protein 2
  KO
K08023  
latent transforming growth factor beta binding protein 2/3/4
Organism
hsa  Homo sapiens (human)
Disease
H01203  
Primary congenital glaucoma (PCG)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24
AA seq 1821 aa AA seqDB search
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQ
TRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWA
ERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLSGLSQTHPSQQHVGLSRTVRL
HPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHH
PPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPV
IENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSR
CVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAF
REICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTW
LEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKG
RCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGY
IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVC
AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACEN
GYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECE
DPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFF
CLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI
DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCD
NTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYD
AQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ
GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG
RCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLD
LSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQ
CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGIL
NGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSY
RCHCSPGYVAEAGPPHCTAKE
NT seq 5466 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgcggaccaaagcccgcagcccggggcgcgccctgcggaacccctggagaggc
ttcctgccgctcaccctggctctcttcgtgggcgcgggtcatgcccaaagggaccccgta
gggagatacgagccggctggtggagacgcgaatcgactgcggcgccctgggggcagctac
ccggcagcggctgcagccaaggtgtacagtctgttccgggagcaggacgcgcctgtcgcg
ggcttgcagcccgtggagcgggcccagccgggctgggggagccccaggaggcccaccgag
gcggaggccaggaggccgtcccgcgcgcagcagtcgcggcgtgtccagccacctgcgcag
acccggagaagcactcccctgggccagcagcaaccagcaccccggacccgggccgcgccg
gctctcccacgcctggggaccccacagcggtctggggctgcgcccccaaccccgccgcga
gggcggctcacggggaggaacgtctgcgggggacagtgctgcccaggatggacaacagca
aacagcaccaaccactgtatcaaacccgtttgcgagccgccgtgccagaaccggggctcc
tgcagccgcccgcagctctgtgtctgccgctctggtttccgtggagcccgctgcgaggag
gtcattcccgatgaggaatttgacccccagaactccaggctggcacctcgacgctgggcc
gagcgttcacccaacctgcgcaggagcagtgcggctggagagggcaccttggccagagca
cagccgccagcaccacagtcgccgcccgcaccacagtcgccaccagctgggaccctgagt
ggcctcagccagacccacccttcccagcagcacgtggggttgtcccgcactgtccgactt
cacccgactgccacggccagtagccagctctcttccaacgccctgcccccgggaccaggc
cttgagcagagagatggcacccaacaggcggtacctctggagcacccctcatccccctgg
gggctgaacctcacggagaaaatcaagaagatcaagatcgtcttcactcccaccatctgc
aagcagacctgtgcccgtggacactgtgccaacagctgtgagaggggcgacaccaccacc
ctgtacagccagggcggccatgggcacgatcccaagtctggcttccgcatctatttctgc
cagatcccctgcctgaacggaggccgctgcatcggcagggacgaatgctggtgccccgcc
aactccaccgggaagttctgccacctgcctatcccgcagccggacagggagcctccaggg
agggggtcccgccccagggccttgctggaagccccactgaagcagtccactttcacactg
ccgctctccaaccagctggcctccgtgaacccctccctggtgaaggtgcacattcaccac
ccacccgaggcctcagtgcagatccaccaggtggcccaggtgcggggcggggtggaggag
gccctagtggagaacagcgtggagaccagacccccgccctggctgcctgccagccctggc
cacagcctctgggacagcaacaacatccctgctcggtctggagagccccctcggccactg
cccccagcagcacccaggcctcgaggactgctgggccggtgttacctgaacactgtgaac
ggacagtgtgccaaccctctgctggagctgactacccaggaggactgctgtggcagtgtg
ggagccttctggggggtgactttgtgtgccccatgcccacccagaccagcctccccggtg
attgagaatggccagctggagtgtcctcaggggtacaagagactgaacctcactcactgc
caagatatcaacgagtgcttgaccctgggcctgtgcaaggacgcggagtgtgtgaatacc
aggggcagctacctgtgcacatgcagacctggcctcatgctggatccatcgcggagccgc
tgtgtgtcggacaaggcaatctccatgctgcagggactgtgctaccggtcgctggggccc
ggcacctgcaccctgcctttggcccagcggatcaccaagcagatatgctgctgcagccgc
gtgggcaaagcatggggcagcgagtgtgagaaatgccctctgcctggcacagaggccttc
agagagatctgccctgccggccacggctacacctacgcgagctccgacatccgcctgtcc
atgaggaaagccgaggaggaggaactggcaaggcccccaagggagcaagggcagaggagc
agcggggcactgcccgggccagcagagaggcagcccctccgggtcgtcacggacacctgg
cttgaggccgggaccatccctgacaagggtgactctcaggctggccaggtcacgaccagt
gtcactcatgcacctgcctgggtcacagggaatgccacaaccccaccaatgcctgaacag
gggattgcagagatacaggaagaacaagtgaccccctccaccgatgtgctggtgaccctg
agcaccccaggcattgacagatgcgctgctggagccaccaacgtctgtggccctggaacc
tgcgtgaacctccccgatggatacagatgtgtctgcagccctggctaccagctgcacccc
agccaggcctactgcacagatgacaacgagtgtctgagggacccctgcaagggaaaaggg
cgctgcatcaaccgcgtggggtcctactcctgcttctgctaccctggctacactctggcc
acctcaggggcgacacaggagtgtcaagatatcaatgagtgtgagcagccaggggtgtgc
agcggggggcagtgcaccaacaccgagggctcgtaccactgcgagtgtgatcagggctac
atcatggtcaggaaaggacactgccaagatatcaacgaatgccgtcaccccggtacctgc
cctgatgggagatgcgtcaattcccctggctcctacacttgtctggcctgtgaggagggc
taccggggccagagtgggagctgtgtagatgtgaatgagtgtctgactcccggggtctgt
gcccatggaaagtgcaccaacctagaaggctccttcagatgctcttgtgagcagggctat
gaggtcacctcagatgagaagggctgccaagatgtggatgagtgtgccagccgggcctca
tgccccacaggcctctgcctcaacacggagggctccttcgcctgctctgcctgtgagaac
gggtactgggtgaatgaagacggcactgcctgtgaagacctagatgagtgtgccttcccg
ggagtctgcccctccggagtctgcaccaacacggctggctccttctcctgcaaggactgc
gatgggggctaccggcccagccccctgggtgactcctgtgaagatgtggatgaatgtgaa
gacccccagagcagctgcctgggaggcgagtgcaagaacactgtgggctcctaccagtgc
ctctgtccccagggcttccagctggccaatggcaccgtgtgtgaggatgtgaatgagtgc
atgggggaggagcactgcgcaccccacggcgagtgcctcaacagccacgggtctttcttc
tgtctgtgcgcgcctggcttcgtcagcgcagaggggggcaccagctgccaggatgtggac
gagtgtgccaccacagacccgtgtgtgggagggcactgtgtcaacaccgagggctccttc
aactgtctatgtgagactggcttccagccctccccagagagtggagagtgtgtggatatt
gacgagtgtgaggactatggagacccggtgtgtggcacctggaagtgtgaaaacagccct
ggctcctaccgctgtgttctgggctgccagcctggcttccacatggccccgaacggagac
tgcattgacatagacgagtgcgccaacgacaccatgtgtggcagccacggcttctgtgac
aacactgatggctccttccgctgcctctgtgaccagggcttcgagatctctccctcaggc
tgggactgtgtggatgtgaacgagtgtgagcttatgctggcggtatgtggggccgcgctc
tgtgagaacgtggagggctccttcctgtgcctctgtgccagtgacctggaggagtacgat
gcccaggaggggcactgccgcccacggggggctggaggtcagagtatgtctgaggcccca
acgggggaccatgccccggcccccacccgcatggactgctactccgggcagaagggccat
gcgccctgctccagtgtcctgggccggaacaccacacaggctgaatgctgctgcacccag
ggcgctagctggggagatgcctgtgacctctgcccgtctgaggactcagctgaattcagc
gagatctgccctagtggaaaaggctacattcctgtggaaggagcctggacgtttggacag
accatgtacacagatgcggatgagtgtgtgatattcgggcctggtctctgcccgaacggc
cggtgcctcaacaccgtgcctggttatgtctgcctgtgcaatcccggcttccactacgat
gcttcccacaagaagtgtgaggatcacgatgagtgccaggacctggcctgtgagaatggc
gagtgcgtcaacacggagggctccttccactgcttctgcagccccccgctcaccctggac
ctcagccagcagcgctgcatgaacagcaccagcagcacggaggacctccctgaccacgac
atccacatggacatctgctggaaaaaagtcaccaatgatgtgtgcagcgaacccctgcgt
gggcaccgcaccacctacacggaatgctgctgccaggacggcgaggcctggagccagcag
tgtgctctgtgtcccccgaggagctctgaggtctatgctcagctgtgcaacgtggctcgc
attgaggcagagcgggaggccggggtccacttccggccaggctatgagtatggccccggg
cccgatgacctgcactacagcatctatggcccagatggggcccccttctacaactacctg
ggccccgaggacaccgtccctgagcctgccttccccaacacagccggtcactcagcggac
cgcacacccatccttgagtctcctttgcagccctcagaactccagccccactacgtggcc
agccatccagagcccccagccggcttcgaagggcttcaggcggaggagtgcggcatcctg
aacggctgtgagaatggccgctgtgtgcgcgtgcgggagggctacacctgtgactgtttt
gagggcttccagctggatgcggcccacatggcctgcgtagatgtgaatgagtgtgatgac
ttgaacgggcctgctgtgctctgtgtccatggttactgcgagaacacagagggctcctac
cgctgccactgctccccgggatatgtggctgaggcagggcccccccactgcactgccaag
gagtag

DBGET integrated database retrieval system