KEGG   Homo sapiens (human): 407Help
Entry
407               CDS       T01001                                 

Gene name
ARR3, ARRX, MYP26, cArr
Definition
(RefSeq) arrestin 3
  KO
K13801  arrestin-C
Organism
hsa  Homo sapiens (human)
Disease
H02041  Myopia
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C CBM49 TUG-UBL1 AP3B1_C
Motif
Other DBs
NCBI-GeneID: 407
NCBI-ProteinID: NP_004303
OMIM: 301770
HGNC: 710
Ensembl: ENSG00000120500
Vega: OTTHUMG00000021768
Pharos: P36575(Tbio)
UniProt: P36575
Position
Xq13.1
AA seq 388 aa AA seqDB search
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASS
EDIVIEEFTRKGEEESQKAVEAEGDEGS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtgtttaagaagaccagctccaatgggaagctctccatctacctggggaaa
cgggacttcgtggaccatgtggacacggtggaacccattgacggtgttgtcctggttgat
cctgagtacttaaaatgtcgaaagttgtttgtcatgttgacatgtgcctttcgctatggc
cgtgatgacttggaagtgattggtctgacgttccgaaaagatctgtatgtgcagaccctg
caagtggtcccagctgaatccagcagccctcaggggcccctcacagtcctacaggagcga
ctactgcacaagctaggggacaatgcctacccctttaccctgcagatggtgaccaacctg
ccctgttctgtgacactgcagccaggtcctgaagatgcaggaaagccctgtgggattgac
tttgaagtgaagagtttctgtgctgaaaacccagaggagacagtctccaagagagactat
gtgcggctggttgtccggaaagtacaatttgcaccaccggaggcaggccctggcccctca
gcccagaccatccgccgcttccttctgtcagctcagcccctacaactccaggcctggatg
gacagggaggttcactaccacggagaacccatctctgtcaatgtttctatcaacaactgc
accaacaaggtcatcaaaaaaatcaagatttcagttgaccagatcacagatgttgtcctg
tattcactagacaagtacaccaagactgtgttcattcaggaattcacggagactgtagct
gctaattccagcttctcccagagctttgcagtaaccccaatcctggctgccagctgccag
aaacggggcctggcactggatggcaaacttaagcatgaagataccaacctggcctctagc
acaattattagaccgggaatggacaaagagctgctggggatcctggtgtcctacaaagtc
agagtcaacctgatggtgtcctgtggtggcatcctaggagacctgacagccagcgatgtt
ggtgtggagctacccttggtcctgatccatccgaagccatctcatgaggccgctagctct
gaggacatagtcatcgaggagtttacgcggaaaggcgaggaggagagccagaaggctgtg
gaggctgagggagatgaggggagctga

DBGET integrated database retrieval system