KEGG   Homo sapiens (human): 407Help
Entry
407               CDS       T01001                                 

Gene name
ARR3, ARRX, cArr
Definition
(RefSeq) arrestin 3 retinal (X-arrestin)
  KO
K13801  
arrestin-C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xcen-q21
AA seq 388 aa AA seqDB search
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASS
EDIVIEEFTRKGEEESQKAVEAEGDEGS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtgtttaagaagaccagctccaatgggaagctctccatctacctggggaaa
cgggacttcgtggaccatgtggacacggtggaacccattgacggtgttgtcctggttgat
cctgagtacttaaaatgtcgaaagttgtttgtcatgttgacatgtgcctttcgctatggc
cgtgatgacttggaagtgattggtctgacgttccgaaaagatctgtatgtgcagaccctg
caagtggtcccagctgaatccagcagccctcaggggcccctcacagtcctacaggagcga
ctactgcacaagctaggggacaatgcctacccctttaccctgcagatggtgaccaacctg
ccctgttctgtgacactgcagccaggtcctgaagatgcaggaaagccctgtgggattgac
tttgaagtgaagagtttctgtgctgaaaacccagaggagacagtctccaagagagactat
gtgcggctggttgtccggaaagtacaatttgcaccaccggaggcaggccctggcccctca
gcccagaccatccgccgcttccttctgtcagctcagcccctacaactccaggcctggatg
gacagggaggttcactaccacggagaacccatctctgtcaatgtttctatcaacaactgc
accaacaaggtcatcaaaaaaatcaagatttcagttgaccagatcacagatgttgtcctg
tattcactagacaagtacaccaagactgtgttcattcaggaattcacggagactgtagct
gctaattccagcttctcccagagctttgcagtaaccccaatcctggctgccagctgccag
aaacggggcctggcactggatggcaaacttaagcatgaagataccaacctggcctctagc
acaattattagaccgggaatggacaaagagctgctggggatcctggtgtcctacaaagtc
agagtcaacctgatggtgtcctgtggtggcatcctaggagacctgacagccagcgatgtt
ggtgtggagctacccttggtcctgatccatccgaagccatctcatgaggccgctagctct
gaggacatagtcatcgaggagtttacgcggaaaggcgaggaggagagccagaaggctgtg
gaggctgagggagatgaggggagctga

DBGET integrated database retrieval system