KEGG   Homo sapiens (human): 4074Help
Entry
4074              CDS       T01001                                 

Gene name
M6PR, CD-M6PR, CD-MPR, MPR_46, MPR-46, MPR46, SMPR
Definition
(RefSeq) mannose-6-phosphate receptor, cation dependent
  KO
K10089  
cation-dependent mannose-6-phosphate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4074 (M6PR)
   04142 Lysosome
    4074 (M6PR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4074 (M6PR)
Lectins [BR:hsa04091]
 P-type lectins
  4074 (M6PR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20645(Tbio)
UniProt: 
Position
12p13.31
AA seq 277 aa AA seqDB search
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
ESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIML
IYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS
PEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGC
DFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttccctttctacagctgctggaggactggactgctactactactcctggctgtggca
gtgagagaatcctggcagacagaagaaaaaacttgcgacttggtaggagaaaagggtaaa
gagtcagagaaagagttggctctagtgaagaggctgaaaccactgtttaataaaagcttt
gagagcactgtgggccagggttcagacacatacatctacatcttcagggtgtgccgggaa
gctggcaaccacacttctggggcaggcctggtgcaaatcaacaaaagtaatgggaaggag
acagtggtagggagactcaacgagactcacatcttcaacggaagtaattggatcatgctg
atctataaagggggtgatgaatatgacaaccactgtggcaaggagcagcgtcgtgcagtg
gtgatgatctcctgcaatcgacacaccctagcggacaattttaaccctgtgtctgaggag
cgtggcaaagtccaagattgtttctacctctttgagatggatagcagcctggcctgttca
ccagagatctcccacctcagtgtgggttccatcttacttgtcacgtttgcatcactggtt
gctgtttatgttgttggggggttcctataccagcgactggtagtgggagccaaaggaatg
gagcagtttccccacttagccttctggcaggatcttggcaacctggtagcagatggctgt
gactttgtctgccgttctaaacctcgaaatgtgcctgcagcatatcgtggtgtgggggat
gaccagctgggggaggagtcagaagaaagggatgaccatttattaccaatgtag

DBGET integrated database retrieval system