KEGG   Homo sapiens (human): 408Help
Entry
408               CDS       T01001                                 

Gene name
ARRB1, ARB1, ARR1
Definition
(RefSeq) arrestin beta 1
  KO
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    408 (ARRB1)
   04340 Hedgehog signaling pathway
    408 (ARRB1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    408 (ARRB1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    408 (ARRB1)
  Sensory system
   04740 Olfactory transduction
    408 (ARRB1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    408 (ARRB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    408 (ARRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49407(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 418 aa AA seqDB search
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaaagggacccgagtgttcaagaaggccagtccaaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctcaaagagcggagagtctatgtgacgctgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacctgttt
gtggccaacgtacagtcgttcccaccggcccccgaggacaagaagcccctgacgcggctg
caggaacgcctcatcaagaagctgggcgagcacgcttaccctttcacctttgagatccct
ccaaaccttccatgttctgtgacactgcagccggggcccgaagacacggggaaggcttgc
ggtgtggactatgaagtcaaagccttctgcgcggagaatttggaggagaagatccacaag
cggaattctgtgcgtctggtcatccggaaggttcagtatgccccagagaggcctggcccc
cagcccacagccgagaccaccaggcagttcctcatgtcggacaagcccttgcacctagaa
gcctctctggataaggagatctattaccatggagaacccatcagcgtcaacgtccacgtc
accaacaacaccaacaagacggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgatgac
actgtggcacccagctcgacgttctgcaaggtctacacactgacccccttcctagccaat
aaccgagagaagcggggcctcgccttggacgggaagctcaagcacgaagacacgaacttg
gcctctagcaccctgttgagggaaggtgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtgaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agcgacgtggccgtggaactgcccttcaccctaatgcaccccaagcccaaagaggaaccc
ccgcatcgggaagttccagagaacgagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgctcgccagagactgaaaggcatgaag
gatgacaaggaggaagaggaggatggtaccggctctccacagctcaacaacagatag

KEGG   Homo sapiens (human): 409Help
Entry
409               CDS       T01001                                 

Gene name
ARRB2, ARB2, ARR2, BARR2
Definition
(RefSeq) arrestin beta 2
  KO
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Dopaminergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    409 (ARRB2)
   04340 Hedgehog signaling pathway
    409 (ARRB2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    409 (ARRB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    409 (ARRB2)
  Nervous system
   04728 Dopaminergic synapse
    409 (ARRB2)
  Sensory system
   04740 Olfactory transduction
    409 (ARRB2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    409 (ARRB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    409 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P32121(Tbio)
UniProt: 
Position
17p13.2
AA seq 409 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccaccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccata
ccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacaggaaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagttcgccccggagaaacccggc
ccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcaatgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaagat
gaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctcagc
gacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggagctg
ccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccagtca
gccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgatcaactctgctag

DBGET integrated database retrieval system