KEGG   Homo sapiens (human): 4082Help
Entry
4082              CDS       T01001                                 

Gene name
MARCKS, 80K-L, MACS, PKCSL, PRKCSL
Definition
(RefSeq) myristoylated alanine rich protein kinase C substrate
  KO
K12561  
myristoylated alanine-rich C-kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    4082 (MARCKS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4082 (MARCKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q22.2
AA seq 332 aa AA seqDB search
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQA
NGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPT
AAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGE
GGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQ
EAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEE
PAAAAASSACAAPSQEAQPECSPEAPPAEAAE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcccagttctccaagaccgcagcgaagggagaagccgccgcggagaggcctggg
gaggcggctgtggcctcgtcgccttccaaagcgaacggacaggagaatggccacgtgaag
gtaaacggcgacgcttcgcccgcggccgccgagtcgggcgccaaggaggagctgcaggcc
aacggcagcgccccggccgccgacaaggaggagcccgcggccgccgggagcggggcggcg
tcgccctccgcggccgagaaaggtgagccggccgccgccgctgcccccgaggccggggcc
agcccggtagagaaggaggcccccgcggaaggcgaggctgccgagcccggctcgcccacg
gccgcggagggagaggccgcgtcggccgcctcctcgacttcttcgcccaaggccgaggac
ggggccacgccctcgcccagcaacgagaccccgaaaaaaaaaaagaagcgcttttccttc
aagaagtctttcaagctgagcggcttctccttcaagaagaacaagaaggaggctggagaa
ggcggtgaggctgaggcgcccgctgccgaaggcggcaaggacgaggccgccgggggcgca
gctgcggccgccgccgaggcgggcgcggcctccggggagcaggcagcggcgccgggcgag
gaggcggcagcgggcgaggagggggcggcgggtggcgacccgcaggaggccaagccccag
gaggccgctgtcgcgccagagaagccgcccgccagcgacgagaccaaggccgccgaggag
cccagcaaggtggaggagaaaaaggccgaggaggccggggccagcgccgccgcctgcgag
gccccctccgccgccgggcccggcgcgcccccggagcaggaggcagcccccgcggaggag
cccgcggccgccgcagcctcgtcagcctgcgcagccccctcacaggaggcccagcccgag
tgcagtccagaagcccccccagcggaggcggcagagtaa

DBGET integrated database retrieval system