KEGG   Homo sapiens (human): 4086Help
Entry
4086              CDS       T01001                                 

Gene name
SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
Definition
SMAD family member 1
Orthology
K04676  
mothers against decapentaplegic homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Transcriptional misregulation in cancer
Disease
H01300  
Primary pulmonary hypertension (PPH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4086 (SMAD1)
   04390 Hippo signaling pathway
    4086 (SMAD1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4086 (SMAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaagtttattttcctttacaagtccagctgtgaagagacttcttgggtgg
aaacagggcgatgaagaagaaaaatgggcagagaaagctgttgatgctttggtgaaaaaa
ctgaagaaaaagaaaggtgccatggaggaactggaaaaggccttgagctgcccagggcaa
ccgagtaactgtgtcaccattccccgctctctggatggcaggctgcaagtctcccaccgg
aagggactgcctcatgtcatttactgccgtgtgtggcgctggcccgatcttcagagccac
catgaactaaaaccactggaatgctgtgagtttccttttggttccaagcagaaggaggtc
tgcatcaatccctaccactataagagagtagaaagccctgtacttcctcctgtgctggtt
ccaagacacagcgaatataatcctcagcacagcctcttagctcagttccgtaacttagga
caaaatgagcctcacatgccactcaacgccacttttccagattctttccagcaacccaac
agccacccgtttcctcactctcccaatagcagttacccaaactctcctgggagcagcagc
agcacctaccctcactctcccaccagctcagacccaggaagccctttccagatgccagct
gatacgcccccacctgcttacctgcctcctgaagaccccatgacccaggatggctctcag
ccgatggacacaaacatgatggcgcctcccctgccctcagaaatcaacagaggagatgtt
caggcggttgcttatgaggaaccaaaacactggtgctctattgtctactatgagctcaac
aatcgtgtgggtgaagcgttccatgcctcctccacaagtgtgttggtggatggtttcact
gatccttccaacaataagaaccgtttctgccttgggctgctctccaatgttaaccggaat
tccactattgaaaacaccaggcggcatattggaaaaggagttcatctttattatgttgga
ggggaggtgtatgccgaatgccttagtgacagtagcatctttgtgcaaagtcggaactgc
aactaccatcatggatttcatcctactactgtttgcaagatccctagtgggtgtagtctg
aaaatttttaacaaccaagaatttgctcagttattggcacagtctgtgaaccatggattt
gagacagtctatgagcttacaaaaatgtgtactatacgtatgagctttgtgaagggctgg
ggagcagaataccaccgccaggatgttactagcaccccctgctggattgagatacatctg
cacggccccctccagtggctggataaagttcttactcaaatgggttcacctcataatcct
atttcatctgtatcttaa

DBGET integrated database retrieval system