KEGG   Homo sapiens (human): 4086Help
Entry
4086              CDS       T01001                                 

Gene name
SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
Definition
SMAD family member 1
Orthology
K04676  
mothers against decapentaplegic homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer
Disease
H01300  
Primary pulmonary hypertension (PPH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4086 (SMAD1)
   04390 Hippo signaling pathway
    4086 (SMAD1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    4086 (SMAD1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4086 (SMAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaagtttattttcctttacaagtccagctgtgaagagacttcttgggtgg
aaacagggcgatgaagaagaaaaatgggcagagaaagctgttgatgctttggtgaaaaaa
ctgaagaaaaagaaaggtgccatggaggaactggaaaaggccttgagctgcccagggcaa
ccgagtaactgtgtcaccattccccgctctctggatggcaggctgcaagtctcccaccgg
aagggactgcctcatgtcatttactgccgtgtgtggcgctggcccgatcttcagagccac
catgaactaaaaccactggaatgctgtgagtttccttttggttccaagcagaaggaggtc
tgcatcaatccctaccactataagagagtagaaagccctgtacttcctcctgtgctggtt
ccaagacacagcgaatataatcctcagcacagcctcttagctcagttccgtaacttagga
caaaatgagcctcacatgccactcaacgccacttttccagattctttccagcaacccaac
agccacccgtttcctcactctcccaatagcagttacccaaactctcctgggagcagcagc
agcacctaccctcactctcccaccagctcagacccaggaagccctttccagatgccagct
gatacgcccccacctgcttacctgcctcctgaagaccccatgacccaggatggctctcag
ccgatggacacaaacatgatggcgcctcccctgccctcagaaatcaacagaggagatgtt
caggcggttgcttatgaggaaccaaaacactggtgctctattgtctactatgagctcaac
aatcgtgtgggtgaagcgttccatgcctcctccacaagtgtgttggtggatggtttcact
gatccttccaacaataagaaccgtttctgccttgggctgctctccaatgttaaccggaat
tccactattgaaaacaccaggcggcatattggaaaaggagttcatctttattatgttgga
ggggaggtgtatgccgaatgccttagtgacagtagcatctttgtgcaaagtcggaactgc
aactaccatcatggatttcatcctactactgtttgcaagatccctagtgggtgtagtctg
aaaatttttaacaaccaagaatttgctcagttattggcacagtctgtgaaccatggattt
gagacagtctatgagcttacaaaaatgtgtactatacgtatgagctttgtgaagggctgg
ggagcagaataccaccgccaggatgttactagcaccccctgctggattgagatacatctg
cacggccccctccagtggctggataaagttcttactcaaatgggttcacctcataatcct
atttcatctgtatcttaa

DBGET integrated database retrieval system