KEGG   Homo sapiens (human): 409Help
Entry
409               CDS       T01001                                 

Gene name
ARRB2, ARB2, ARR2, BARR2
Definition
arrestin, beta 2
Orthology
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Dopaminergic synapse
Olfactory transduction
Phototransduction
Morphine addiction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Sensory system; Phototransduction [PATH:hsa04744]
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 430 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTV
RMPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKS
HKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNV
HVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLL
SDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE
LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGM
KDDDYDDQLC
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccaccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccgtg
aggatgcccctgccctctgagggccagggggctggggctgggactgtgtctggggtgggg
ataccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacaggaaag
gcctgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagc
cacaaaaggaactctgtgcggctggtgatccgaaaggtgcagttcgccccggagaaaccc
ggcccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcac
ctcgaggcttccctggacaaggagctgtactaccatggggagcccctcaatgtaaatgtc
cacgtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtac
gccgacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaa
gatgaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctc
agcgacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacacc
aacctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctg
gtgtcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggag
ctgccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccag
tcagccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaac
tatgccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatg
aaggatgacgactatgatgatcaactctgctag

DBGET integrated database retrieval system