KEGG   Homo sapiens (human): 409Help
Entry
409               CDS       T01001                                 

Gene name
ARRB2, ARB2, ARR2, BARR2
Definition
(RefSeq) arrestin, beta 2
  KO
K04439  
beta-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Dopaminergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    409 (ARRB2)
   04340 Hedgehog signaling pathway
    409 (ARRB2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    409 (ARRB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    409 (ARRB2)
  Nervous system
   04728 Dopaminergic synapse
    409 (ARRB2)
  Sensory system
   04740 Olfactory transduction
    409 (ARRB2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    409 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 409 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccaccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccata
ccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacaggaaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactctgtgcggctggtgatccgaaaggtgcagttcgccccggagaaacccggc
ccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcaatgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaagat
gaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctcagc
gacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggagctg
ccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccagtca
gccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgatcaactctgctag

DBGET integrated database retrieval system