KEGG   Homo sapiens (human): 4090Help
Entry
4090              CDS       T01001                                 

Gene name
SMAD5, DWFC, JV5-1, MADH5
Definition
SMAD family member 5
Orthology
K16790  
mothers against decapentaplegic homolog 5
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4090 (SMAD5)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    4090 (SMAD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
5q31
AA seq 465 aa AA seqDB search
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggccagcttgttttcttttactagtccagcagtaaagcgattgttgggc
tggaaacaaggtgatgaggaggagaaatgggcagaaaaggcagttgatgctttggtgaag
aaactaaaaaagaaaaagggtgccatggaggaactggagaaagccttgagcagtccagga
cagccgagtaaatgtgtcactattcccagatctttagatggacgcctgcaggtttctcac
agaaaaggcttaccccatgttatatattgtcgtgtttggcgctggccggatttgcagagt
catcatgagctaaagccgttggatatttgtgaatttccttttggatctaagcaaaaagaa
gtttgtatcaacccataccactataagagagtggagagtccagtcttacctccagtatta
gtgcctcgtcataatgaattcaatccacaacacagccttctggttcagtttaggaacctg
agccacaatgaaccacacatgccacaaaatgccacgtttccagattctttccaccagccc
aacaacactccttttcccttatctccaaacagcccttatcccccttctcctgctagcagc
acatatcccaactccccagcaagttctggaccaggaagtccatttcagctcccagctgat
acgcctcctcctgcctatatgccacctgatgatcagatgggtcaagataattcccagcct
atggatacaagcaataatatgattcctcagattatgcccagtatatccagcagggatgtt
cagcctgttgcctatgaagagcctaaacattggtgttcaatagtctactatgaattaaac
aatcgtgttggagaagcttttcatgcatcttctactagtgtgttagtagatggattcaca
gatccttcaaataacaaaagtagattctgcttgggtttgttgtcaaatgttaatcgtaat
tcgacaattgaaaacactaggcgacatattggaaaaggtgttcatctgtactatgttggt
ggagaggtgtatgcggaatgcctcagtgacagcagcatatttgtacagagtaggaactgc
aactttcatcatggctttcatcccaccactgtctgtaagattcccagcagctgcagcctc
aaaatttttaacaatcaggagtttgctcagcttctggctcaatctgtcaaccatgggttt
gaggcagtatatgagctcaccaaaatgtgtaccattcggatgagttttgtcaagggttgg
ggagcagaatatcaccggcaggatgtaaccagcaccccatgttggattgagattcatctt
catgggcctcttcagtggctggataaagtccttactcagatgggctcccctctgaacccc
atatcttctgtttcataa

DBGET integrated database retrieval system