KEGG   Homo sapiens (human): 411Help
Entry
411               CDS       T01001                                 

Gene name
ARSB, ASB, G4S, MPS6
Definition
(RefSeq) arylsulfatase B (EC:3.1.6.12)
  KO
K01135  
arylsulfatase B [EC:3.1.6.12]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Dermatan sulfate degradation
Chondroitin sulfate degradation
Disease
H00131  
Mucopolysaccharidosis type VI (MPS6)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    411 (ARSB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    411 (ARSB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     411 (ARSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q14.1
AA seq 533 aa AA seqDB search
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDV
GFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPS
CVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHER
CTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQS
VHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTD
NGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKL
ARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRD
PEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgcgcggcgcggcgagcttgccccgaggccccggacctcggcggctgctcctc
cccgtcgtcctcccgctgctgctgctgctgttgttggcgccgccgggctcgggcgccggg
gccagccggccgccccacctggtcttcttgctggcagacgacctaggctggaacgacgtc
ggcttccacggctcccgcatccgcacgccgcacctggacgcgctggcggccggcggggtg
ctcctggacaactactacacgcagccgctgtgcacgccgtcgcggagccagctgctcact
ggccgctaccagatccgtacaggtttacagcaccaaataatctggccctgtcagcccagc
tgtgttcctctggatgaaaaactcctgccccagctcctaaaagaagcaggttatactacc
catatggtcggaaaatggcacctgggaatgtaccggaaagaatgccttccaacccgccga
ggatttgatacctactttggatatctcctgggtagtgaagattattattcccatgaacgc
tgtacattaattgacgctctgaatgtcacacgatgtgctcttgattttcgagatggcgaa
gaagttgcaacaggatataaaaatatgtattcaacaaacatattcaccaaaagggctata
gccctcataactaaccatccaccagagaagcctctgtttctctaccttgctctccagtct
gtgcatgagccccttcaggtccctgaggaatacttgaagccatatgactttatccaagac
aagaacaggcatcactatgcaggaatggtgtcccttatggatgaagcagtaggaaatgtc
actgcagctttaaaaagcagtgggctctggaacaacacggtgttcatcttttctacagat
aacggagggcagactttggcagggggtaataactggccccttcgaggaagaaaatggagc
ctgtgggaaggaggcgtccgaggggtgggctttgtggcaagccccttgctgaagcagaag
ggcgtgaagaaccgggagctcatccacatctctgactggctgccaacactcgtgaagctg
gccaggggacacaccaatggcacaaagcctctggatggcttcgacgtgtggaaaaccatc
agtgaaggaagcccatcccccagaattgagctgctgcataatattgacccgaacttcgtg
gactcttcaccgtgtcccaggaacagcatggctccagcaaaggatgactcttctcttcca
gaatattcagcctttaacacatctgtccatgctgcaattagacatggaaattggaaactc
ctcacgggctacccaggctgtggttactggttccctccaccgtctcaatacaatgtttct
gagataccctcatcagacccaccaaccaagaccctctggctctttgatattgatcgggac
cctgaagaaagacatgacctgtccagagaatatcctcacatcgtcacaaagctcctgtcc
cgcctacagttctaccataaacactcagtccccgtgtacttccctgcacaggacccccgc
tgtgatcccaaggccactggggtgtggggcccttggatgtag

DBGET integrated database retrieval system