KEGG   Homo sapiens (human): 4116Help
Entry
4116              CDS       T01001                                 

Gene name
MAGOH, MAGOH1, MAGOHA
Definition
(RefSeq) mago homolog, exon junction complex core component
  KO
K12877  
protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    4116 (MAGOH)
  Translation
   03013 RNA transport
    4116 (MAGOH)
   03015 mRNA surveillance pathway
    4116 (MAGOH)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4116 (MAGOH)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    4116 (MAGOH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 146 aa AA seqDB search
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgacttttatctgcgttactacgtggggcacaagggcaagttcggccacgag
ttcctggagtttgagtttcgaccggacgggaagttaagatatgccaacaacagcaattac
aagaatgatgtcatgatcagaaaagaggcttatgtacataaaagcgtgatggaggaactg
aagagaataattgacgacagtgaaattaccaaagaggatgatgcattgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgtcattggagatgaacacatttcttttaca
acatcaaaaattggttcccttattgatgtcaatcaatccaaggatccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

DBGET integrated database retrieval system