KEGG   Homo sapiens (human): 4116Help
Entry
4116              CDS       T01001                                 

Gene name
MAGOH, MAGOH1, MAGOHA
Definition
mago-nashi homolog, proliferation-associated (Drosophila)
Orthology
K12877  
protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    4116 (MAGOH)
  Translation
   03013 RNA transport
    4116 (MAGOH)
   03015 mRNA surveillance pathway
    4116 (MAGOH)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    4116 (MAGOH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 146 aa AA seqDB search
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgacttttatctgcgttactacgtggggcacaagggcaagttcggccacgag
ttcctggagtttgagtttcgaccggacgggaagttaagatatgccaacaacagcaattac
aagaatgatgtcatgatcagaaaagaggcttatgtacataaaagcgtgatggaggaactg
aagagaataattgacgacagtgaaattaccaaagaggatgatgcattgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgtcattggagatgaacacatttcttttaca
acatcaaaaattggttcccttattgatgtcaatcaatccaaggatccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

DBGET integrated database retrieval system