KEGG   Homo sapiens (human): 4116Help
Entry
4116              CDS       T01001                                 

Gene name
MAGOH, MAGOH1, MAGOHA
Definition
mago-nashi homolog, proliferation-associated (Drosophila)
Orthology
K12877  
protein mago nashi
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 146 aa AA seqDB search
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL
KRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR
VFYYLVQDLKCLVFSLIGLHFKIKPI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgacttttatctgcgttactacgtggggcacaagggcaagttcggccacgag
ttcctggagtttgagtttcgaccggacgggaagttaagatatgccaacaacagcaattac
aagaatgatgtcatgatcagaaaagaggcttatgtacataaaagcgtgatggaggaactg
aagagaataattgacgacagtgaaattaccaaagaggatgatgcattgtggcctcctcct
gaccgagtgggccggcaggagcttgaaatcgtcattggagatgaacacatttcttttaca
acatcaaaaattggttcccttattgatgtcaatcaatccaaggatccagaaggcttacga
gtattttattatcttgtccaggacctgaagtgtttggtcttcagtcttattggattacac
ttcaagattaaaccaatctag

DBGET integrated database retrieval system