KEGG   Homo sapiens (human): 4117Help
Entry
4117              CDS       T01001                                 

Gene name
MAK, RP62
Definition
(RefSeq) male germ cell associated kinase (EC:2.7.11.22)
  KO
K08829  
male germ cell-associated kinase [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     4117 (MAK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  RCK family [OT]
   4117 (MAK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p24
AA seq 623 aa AA seqDB search
MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSP
IDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQ
CVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESK
QSLNKQLQPLESKPSLVEVEPKPLPDIIDQVVGQPQPKTSQQPLQPIQPPQNLSVQQPPK
QQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHS
KKPSMGVFKEKRKKDSPFRLPEPVPSGSNHSTGENKSLPAVTSLKSDSELSTAPTSKQYY
LKQSRYLPGVNPKKVSLIASGKEINPHTWSNQLFPKSLGPVGAELAFKRSNAGNLGSYAT
YNQSGYIPSFLKKEVQSAGQRIHLAPLNATASEYTWNTKTGRGQFSGRTYNPTAKNLNIV
NRAQPIPSVHGRTDWVAKYGGHR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatacacaaccatgagacagttgggggacggcacgtatgggagtgtgcttatg
ggcaagagtaatgaatccggggagctggtggccatcaaaaggatgaagagaaagttctat
tcttgggatgaatgcatgaacttgagagaagttaagtctctgaagaaacttaatcatgcc
aatgttattaaattgaaagaagttatcagagaaaatgaccatctttattttatatttgaa
tatatgaaagaaaacctctatcaattaatgaaagacagaaacaagttgttccctgaatca
gtcatcagaaatattatgtatcaaatattgcaagggctggcttttatccataaacatggc
ttttttcatagggacatgaaaccagaaaacttgctttgtatgggtccagagcttgtgaaa
attgctgattttggacttgcaagagaattaaggtcacagccaccatacactgattatgta
tctaccagatggtatcgtgcccctgaagttttactgagatcttcagtttatagttctccc
attgatgtgtgggctgttggaagtatcatggctgaactctatatgttaaggccacttttc
ccagggacaagtgaggtcgatgaaatctttaaaatttgccaagttttagggactcccaaa
aaaagtgactggccagaaggataccagctggcatcctctatgaacttccgttttccccag
tgtgttcctataaacttaaaaactcttattcccaatgccagtaatgaagctattcagctc
atgaccgaaatgttgaattgggatccaaagaaacgaccgacagcaagccaggcattgaaa
cacccatattttcaagttggtcaggtattaggcccttcgtcaaatcatctggaatcaaaa
cagtctttaaataagcagctgcaaccattagaatcaaagccatctttagttgaggtagag
cctaagcctctgccggatataatcgatcaggttgttggacaaccccagccaaaaactagc
cagcagccactgcagcccattcagccgccacagaacctgagcgtccagcaacctccaaag
caacagagtcaggagaaaccgccacaaacgctattcccgagcatcgtcaaaaacatgcca
actaagccaaatggcacactgagtcataaaagtggtaggaggcgttggggtcagactatc
ttcaagtctggagatagctgggaagagttggaggactatgatttcggagcctcccattcc
aagaagccaagcatgggtgtttttaaagaaaaaaggaaaaaagattctccatttcggctt
ccagagccagtaccctcaggctccaaccactcgacaggggaaaacaagagcttacctgct
gttacttccctaaaatctgattccgaattgtcaactgctccaacctctaaacagtactac
ttgaaacaatcaagatatcttccaggtgtgaatcccaagaaggtgtccttgatagccagt
ggaaaggaaataaacccccacacttggagcaaccagttattccccaagtcactgggaccc
gttggggcagaacttgctttcaaaaggagcaatgcaggaaatcttggaagttatgctact
tacaatcagtcaggatatattccttcctttctcaaaaaagaagtgcagtcagctggccag
aggatccacttagcacctctcaatgcaacggcttcagaatatacctggaacacaaaaact
ggtcgggggcagttttcaggacgtacttataatcctacagcaaaaaacctaaatattgtg
aaccgtgcacagcccattccctcagtgcatgggaggacagactgggtggccaagtatgga
ggccaccggtag

DBGET integrated database retrieval system