KEGG   Homo sapiens (human): 4128Help
Entry
4128              CDS       T01001                                 

Gene name
MAOA, MAO-A
Definition
monoamine oxidase A (EC:1.4.3.4)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00548  
Brunner syndrome
Drug target
Amezinium metilsulfate: 
Pargyline: 
Isoniazid: 
Isocarboxazid: 
Nialamide: 
Phenelzine: 
Tranylcypromine: 
Iproniazide: 
Iproclozide: 
Moclobemide: 
Toloxatone: 
Minaprine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4128 (MAOA)
   00330 Arginine and proline metabolism
    4128 (MAOA)
   00340 Histidine metabolism
    4128 (MAOA)
   00350 Tyrosine metabolism
    4128 (MAOA)
   00360 Phenylalanine metabolism
    4128 (MAOA)
   00380 Tryptophan metabolism
    4128 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    4128 (MAOA)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    4128 (MAOA)
   04726 Serotonergic synapse
    4128 (MAOA)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    4128 (MAOA)
   05031 Amphetamine addiction
    4128 (MAOA)
   05034 Alcoholism
    4128 (MAOA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     4128 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3
AA seq 527 aa AA seqDB search
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcaagagaaggcgagtatcgcgggccacatgttcgacgtagtcgtgatcgga
ggtggcatttcaggactatctgctgccaaactcttgactgaatatggcgttagtgttttg
gttttagaagctcgggacagggttggaggaagaacatatactataaggaatgagcatgtt
gattacgtagatgttggtggagcttatgtgggaccaacccaaaacagaatcttacgcttg
tctaaggagctgggcatagagacttacaaagtgaatgtcagtgagcgtctcgttcaatat
gtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgca
tatttggattacaataatctgtggaggacaatagataacatggggaaggagattccaact
gatgcaccctgggaggctcaacatgctgacaaatgggacaaaatgaccatgaaagagctc
attgacaaaatctgctggacaaagactgctaggcggtttgcttatctttttgtgaatatc
aatgtgacctctgagcctcacgaagtgtctgccctgtggttcttgtggtatgtgaagcag
tgcgggggcaccactcggatattctctgtcaccaatggtggccaggaacggaagtttgta
ggtggatctggtcaagtgagcgaacggataatggacctcctcggagaccaagtgaagctg
aaccatcctgtcactcacgttgaccagtcaagtgacaacatcatcatagagacgctgaac
catgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaag
attcacttcagaccagagcttccagcagagagaaaccagttaattcagcggcttccaatg
ggagctgtcattaagtgcatgatgtattacaaggaggccttctggaagaagaaggattac
tgtggctgcatgatcattgaagatgaagatgctccaatttcaataaccttggatgacacc
aagccagatgggtcactgcctgccatcatgggcttcattcttgcccggaaagctgatcga
cttgctaagctacataaggaaataaggaagaagaaaatctgtgagctctatgccaaagtg
ctgggatcccaagaagctttacatccagtgcattatgaagagaagaactggtgtgaggag
cagtactctgggggctgctacacggcctacttccctcctgggatcatgactcaatatgga
agggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaag
tggagcggctacatggaaggggcagttgaggctggagaacgagcagctagggaggtctta
aatggtctcgggaaggtgaccgagaaagatatctgggtacaagaacctgaatcaaaggac
gttccagcggtagaaatcacccacaccttctgggaaaggaacctgccctctgtttctggc
ctgctgaagatcattggattttccacatcagtaactgccctggggtttgtgctgtacaaa
tacaagctcctgccacggtcttga

DBGET integrated database retrieval system