KEGG   Homo sapiens (human): 4128Help
Entry
4128              CDS       T01001                                 

Gene name
MAOA, MAO-A
Definition
monoamine oxidase A (EC:1.4.3.4)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00548  
Brunner syndrome
Drug target
Amezinium metilsulfate: 
Pargyline: 
Isoniazid: 
Isocarboxazid: 
Nialamide: 
Phenelzine: 
Tranylcypromine: 
Iproniazide: 
Iproclozide: 
Moclobemide: 
Toloxatone: 
Minaprine: 
Other: 
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hsa00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3
AA seq 527 aa AA seqDB search
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcaagagaaggcgagtatcgcgggccacatgttcgacgtagtcgtgatcgga
ggtggcatttcaggactatctgctgccaaactcttgactgaatatggcgttagtgttttg
gttttagaagctcgggacagggttggaggaagaacatatactataaggaatgagcatgtt
gattacgtagatgttggtggagcttatgtgggaccaacccaaaacagaatcttacgcttg
tctaaggagctgggcatagagacttacaaagtgaatgtcagtgagcgtctcgttcaatat
gtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgca
tatttggattacaataatctgtggaggacaatagataacatggggaaggagattccaact
gatgcaccctgggaggctcaacatgctgacaaatgggacaaaatgaccatgaaagagctc
attgacaaaatctgctggacaaagactgctaggcggtttgcttatctttttgtgaatatc
aatgtgacctctgagcctcacgaagtgtctgccctgtggttcttgtggtatgtgaagcag
tgcgggggcaccactcggatattctctgtcaccaatggtggccaggaacggaagtttgta
ggtggatctggtcaagtgagcgaacggataatggacctcctcggagaccaagtgaagctg
aaccatcctgtcactcacgttgaccagtcaagtgacaacatcatcatagagacgctgaac
catgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaag
attcacttcagaccagagcttccagcagagagaaaccagttaattcagcggcttccaatg
ggagctgtcattaagtgcatgatgtattacaaggaggccttctggaagaagaaggattac
tgtggctgcatgatcattgaagatgaagatgctccaatttcaataaccttggatgacacc
aagccagatgggtcactgcctgccatcatgggcttcattcttgcccggaaagctgatcga
cttgctaagctacataaggaaataaggaagaagaaaatctgtgagctctatgccaaagtg
ctgggatcccaagaagctttacatccagtgcattatgaagagaagaactggtgtgaggag
cagtactctgggggctgctacacggcctacttccctcctgggatcatgactcaatatgga
agggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaag
tggagcggctacatggaaggggcagttgaggctggagaacgagcagctagggaggtctta
aatggtctcgggaaggtgaccgagaaagatatctgggtacaagaacctgaatcaaaggac
gttccagcggtagaaatcacccacaccttctgggaaaggaacctgccctctgtttctggc
ctgctgaagatcattggattttccacatcagtaactgccctggggtttgtgctgtacaaa
tacaagctcctgccacggtcttga

DBGET integrated database retrieval system