KEGG   Homo sapiens (human): 4131Help
Entry
4131              CDS       T01001                                 

Gene name
MAP1B, FUTSCH, MAP5, PPP1R102
Definition
(RefSeq) microtubule associated protein 1B
  KO
K10429  
microtubule-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4131 (MAP1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     4131 (MAP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13
AA seq 2468 aa AA seqDB search
MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIE
LGIRSWDTNLIECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAV
STEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHP
ANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVP
SPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRH
LDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLN
VPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKL
EMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANP
AEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRAD
SRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKP
SVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEV
AKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEVKKETPPKEVKKEVKKEEKKE
VKKEEKEPKKEIKKLPKDAKKSSTPLSEAKKPAALKPKVPKKEESVKKDSVAAGKPKEKG
KIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEAERSLMSSPEDLTKDF
EELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTE
GEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEE
HVCVSASKHSPTEDEESAKAEADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEA
DEEDKAEDAREEEYEPEKMEAEDYVMAVVDKAAEAGGAEEQYGFLTTPTKQLGAQSPGRE
PASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPMDEMSTPR
DVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGSKTDATDGKDY
NASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLS
PSPPSPLEKTPLGERSVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEV
VSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPM
DEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPD
QVSPVSEMTSTSLYQDKQEGKSTDFAPIKEDFGQEKKTDDVEAMSSQPALALDERKLGDV
SPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVATS
SFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSIS
PPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEQSLAMDFSRQSPDHPTVGAGVLHIT
ENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQ
IASPLQEDTLSDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTF
SDSTSAVKEKTATCHSSSSPPIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDS
GGKTPGDFSYAYQKPEETTRSPDEEDYDYESYEKTTRTSDVGGYYYEKIERTTKSPSDSG
YSYETIGKTTKTPEDGDYSYEIIEKTTRTPEEGGYSYDISEKTTSPPEVSGYSYEKTERS
RRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSYETSTKTTRTPDTSTY
CYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS
FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDS
DVPPETEECPSITADANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMV
DPEALAIEQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKES
SDKVSRVASPKKKESVEKAAKPTTTPEVKAARGEEKDKETKNAANASASKSAKTATAGPG
TTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRA
VLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDES
FPACKIEL
NT seq 7407 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgtggtggtggaagccaccgagccggagccgtccggcagcatcgccaacccg
gcggcgtccacctcgcctagcctgtcgcaccgcttccttgacagcaagttctacttgctg
gtggtcgtcggcgagatcgtgaccgaggagcacctgcggcgtgccatcggcaacatcgag
ctcggaatccgatcatgggacacaaacctgattgaatgcaacttggaccaagaactcaaa
ctttttgtatctcgacactctgcaagattctctcctgaagtcccaggacaaaagatcctt
catcaccgaagtgacgttttagaaacagtggtcctgatcaacccttctgatgaagcagtc
agcaccgaggtgcgcttaatgatcactgatgctgcccgacacaagctgctcgtgctgacc
gggcagtgctttgaaaataccggagagctcattctccagtccggctctttctccttccag
aacttcatagagattttcaccgatcaagagatcggggagttactaagcaccacccatcct
gccaacaaagccagcttaaccctgttctgtcctgaagaaggggactggaagaactccaat
cttgacagacacaatctccaagacttcatcaatattaaactcaattcagcttctatcttg
ccagaaatggaaggactttctgagtttaccgagtatctctcagaatcagtggaagtccca
tctccctttgacatcttggaacctcccacatcgggtggatttctgaagctctccaagccc
tgctgttatatttttccaggagggaggggcgattctgccttgtttgcagtgaatggtttc
aatatgctcatcaatggcggatcagagagaaaatcctgcttctggaagctcatccgacac
ttagaccgagtggactccatcctgctcacccacattggggatgacaatttgcctggaata
aacagcatgttacagcggaaaattgcagagctcgaggaagaacagtcccagggctccacc
acaaatagtgactggatgaaaaacctcatctcccctgacttaggagttgtatttctcaat
gtacctgaaaatctcaaaaatccagagccaaacatcaagatgaagagaagcatagaagaa
gcctgcttcactctccagtacctaaacaaattgtccatgaaaccagaacctctgtttaga
agtgtaggcaatactattgatcctgtcattcttttccaaaaaatgggagtaggtaaactt
gagatgtatgtgcttaatccagtcaagagcagcaaggaaatgcagtattttatgcagcag
tggactggtaccaacaaagacaaggctgaattcattctgcctaatggtcaagaagtagat
ctcccgatttcctacttaacttcagtctcatctttgattgtgtggcatccagcaaaccct
gcggagaaaatcatccgagtcctgtttcctgggaacagcacccagtacaacatcctggaa
gggttggaaaagctcaaacatctagactttctgaagcagccactggccacccaaaaggat
ctcactggccaggtgcccactcctgtggtgaaacaaacaaaactgaaacagagggctgat
agccgagaaagtctgaagccagccgcaaaaccacttcctagcaaatccgtgcgcaaggag
tcaaaagaagaaacccctgaggtcacaaaagtgaatcacgtggaaaagccacccaaagtt
gaaagcaaagaaaaggtaatggtgaaaaaagacaagccaataaaaacagagaccaaacct
tcagtgactgaaaaggaggttcccagcaaagaagagccatctccagtgaaagccgaggtg
gctgagaagcaagccacagatgtcaaacccaaagctgccaaggagaagacggtgaaaaag
gaaacaaaggtaaagcctgaagacaagaaagaggagaaagaaaagccaaagaaagaagtg
gctaaaaaggaggacaaaacacctatcaagaaggaggaaaaaccaaaaaaggaagaggtg
aaaaaagaagtcaaaaaagagatcaagaaagaagagaaaaaagaacccaagaaagaggtt
aagaaagaaacaccgccaaaggaagtcaagaaggaagttaagaaggaagagaagaaggaa
gtgaaaaaggaagaaaaggaacccaaaaaagaaattaagaagctccctaaagacgcaaag
aaatcatctactcctctgtctgaagcaaaaaaaccagctgctttaaaaccaaaagtaccc
aagaaggaagagtctgtcaagaaagattctgttgctgccggaaagccaaaggagaagggg
aaaataaaagtcattaagaaggaaggcaaggccgcagaggctgtcgctgcagctgtcggc
actggagccaccacagcagctgtcatggcggcagctggaatagcagccattggccctgcc
aaagaactcgaagctgagaggtcccttatgtcatctcctgaggatctaaccaaggacttt
gaagagttaaaggctgaagaggtcgatgtaacaaaggacatcaagcctcagctggagcta
atcgaagacgaagagaaactgaaggaaactgagccagtcgaagcctacgtcatccagaag
gagagagaagtcaccaaaggtcctgccgagtcccctgatgagggaatcactaccactgaa
ggggagggcgaatgtgaacagacacctgaggagctggagcccgtcgagaagcagggagta
gacgacattgaaaaatttgaagatgaaggagccggttttgaagaatcttcagagactgga
gactatgaagagaaggcagaaactgaggaggctgaggagccagaagaggatggggaggaa
cacgtatgtgtgagcgcctccaagcacagccccactgaggatgaggaaagtgccaaggcg
gaggctgatgcatacatcagggagaagagggagtctgtggccagtggggatgaccgagcc
gaagaagacatggatgaggccattgagaaaggagaggctgaacaatctgaagaggaggct
gatgaggaggacaaagctgaagatgccagagaggaggaatatgagccggaaaaaatggaa
gctgaagactatgtgatggctgtggtcgacaaggctgcagaggctggtggtgccgaggag
cagtatggattcctcaccacaccaaccaagcaactaggagcccagtctcctggccgagaa
cctgcatcttcaattcatgatgagactttacctggaggctcagagagcgaggccaccgct
tctgatgaggagaatcgagaagaccagcctgaggaattcactgccacctctggctacact
cagtctactattgagatatccagtgagcccacccccatggatgagatgtctacccctcga
gacgtgatgagtgatgagaccaacaatgaagagacggagtccccttctcaggaattcgta
aatatcaccaaatatgaatcttcattgtattctcaggaatactctaaacctgctgatgtt
acaccgctcaacggattttctgaaggatcaaaaacagatgccactgatggcaaggattac
aatgcttcagcctctaccatatcaccaccctcttccatggaggaagacaaattcagcaga
tctgctttacgtgatgcttactgctctgaagtgaaagccagcaccactttggacatcaaa
gatagcatctcagctgtttcaagtgaaaaggtcagcccatcgaagagcccgtccctgagt
ccatctccaccatcacccttagaaaagacccccctgggtgaacgtagtgtgaacttctct
ctgacgcccaatgagattaaagtctctgcagaggcagaagtagccccggtgtctcctgag
gtgacccaagaagtagttgaagaacattgtgctagtcctgaggacaagactctggaagtg
gtgtcaccatctcagtccgtgactggcagtgctggtcacacaccttactatcaatctcct
actgacgagaaatccagtcatctccctacagaagtcattgaaaaaccaccagcagttcca
gtgagttttgaattcagtgatgccaaagatgagaatgaaagggcttcagtaagccccatg
gatgagcccgtgcctgactcagagtctcctattgaaaaagttttgtctcctttacgcagc
ccgcccctcattggatccgagtctgcttatgaaagttttctaagtgctgatgacaaggct
tctggcagaggtgccgaaagtccttttgaagaaaagagtggaaaacaaggctctccagac
caagtaagtccagtttctgaaatgacttctactagtctttaccaagacaaacaggaaggg
aaaagcacagactttgcaccaataaaagaagactttggccaagaaaagaaaactgatgat
gttgaagccatgagttctcaaccagcactggctctggatgaaaggaaattaggagatgtt
tctcccacacaaatagatgtcagtcagtttggatcttttaaagaagacactaagatgtcc
atttctgaaggtactgtctcagacaagtcagctactcctgttgatgagggcgtagcagaa
gacacgtactctcatatggagggtgtggcctcagtgtccacagcctcagtggctacgagc
tcatttccagagccaacaacagatgatgtgtctccatctctgcatgctgaggttggctcc
ccacattccacagaagtagatgactccctttcagtgtctgttgtgcaaacacctaccaca
ttccaggaaacagaaatgtctccatctaaagaagaatgcccaagaccgatgtcaatttct
ccaccagatttctcccctaaaactgcaaagtccaggacacccgttcaagatcacagatct
gaacagtcctcaatgtctattgaatttggccaagaatctcctgagcaatcccttgctatg
gacttcagtcgacagtctccagatcaccctacagtgggtgcaggcgtgcttcacatcact
gaaaatgggccaactgaagtggactacagtccttctgacatgcaggactccagtttatca
cataagataccacctatggaggagccgtcctacacccaagataatgatctttctgagctc
atctcagtatctcaggtagaggcctccccgtccacctcttctgctcataccccttctcag
atcgcttctcctctccaagaagatactctatccgatgttgctcctcccagagatatgtcc
ttatatgcctcactcacctctgaaaaagtgcaaagtctggaaggagagaagctctctcca
aaatctgatatctctccactcaccccacgagagtcctctcctttatattcacctactttt
tcagattctacctctgcagtcaaagagaaaacagcaacttgccacagttcctcttctcca
ccaatagatgcagcatccgcagagccctatggcttccgtgcctcagtgttattcgataca
atgcaacaccatctagccttgaatagagatttgtccacacctggcctggagaaggacagt
ggagggaagacacctggtgactttagctatgcctatcaaaagcctgaggaaacaaccagg
tccccagatgaagaagattatgactatgagtcttatgagaagaccacccggacctcagat
gtgggtggctattactatgagaagatagagagaaccacaaaatctccaagtgacagtggc
tactcctatgagaccattgggaaaactaccaagacccctgaagatggtgactattcctat
gaaattattgagaagaccacacggacccctgaagagggtgggtactcatatgacataagt
gaaaagaccaccagcccccccgaagtgagtggttacagctatgaaaagactgagaggtct
agaaggcttctggatgacatcagcaatggctatgatgactctgaggatggtggccacaca
cttggggaccccagctactcttatgaaaccactgagaaaattaccagtttccctgagtct
gaaggttattcctatgagacatctacaaagacaacacgaacccctgatacttccacatac
tgttacgagactgcagagaaaatcactagaacccctcaggcatccacatattcctacgag
acttcagacctatgctacactgcagaaaagaagtccccctcagaagcccgtcaggatgtc
gatttatgcctcgtgtcctcttgtgaatacaagcaccccaagacagagctttcaccctct
ttcattaatcccaatcctcttgagtggtttgccagtgaagaacccactgaagaatctgaa
aagcccctcactcaatcagggggagccccaccgcctccaggaggaaagcaacagggccga
cagtgtgatgaaacccctcccacctcagtcagcgagtcagccccatcccagaccgactct
gatgttcccccggagactgaagagtgcccctccatcacggccgatgccaatatcgactct
gaagacgagtcggaaaccatccccacagacaaaactgtcacgtacaaacacatggaccca
cctccagctcccgtgcaagaccgcagcccttcgccacgccaccctgatgtgtccatggtg
gacccagaggccttggccattgagcagaacctgggcaaagctctaaagaaagatctgaaa
gagaagaccaaaaccaaaaagccaggtacaaagaccaagtcatcttcacctgtcaaaaag
agtgatgggaagtctaagcccttggcagcttcaccaaaaccagcgggcttgaaagaatcc
tcggataaagtgtccagggtggcttctcctaagaagaaagaatctgtggaaaaggcagca
aaacccaccaccactcctgaggtcaaagctgcacgtggggaagagaaagacaaggagacc
aagaatgctgccaatgcctctgcatccaagtcggccaagaccgccactgcaggaccagga
actaccaagacgaccaagtcatctgctgtgcccccaggcctccctgtgtatttggacctg
tgctacattcctaaccacagcaatagtaagaatgttgatgtggaatttttcaagagagtg
cggtcttcctactacgtggtgagtgggaatgaccctgctgctgaggagcccagccgggct
gtcctggacgctttgttggaaggaaaggctcagtggggcagcaacatgcaggtgacactg
atcccaactcatgactcagaagtgatgagggaatggtaccaggagacccatgagaaacag
caagatctcaacatcatggttttagcaagcagcagcacagtggttatgcaagatgaatcc
ttccctgcatgcaagattgaactgtaa

DBGET integrated database retrieval system