KEGG   Homo sapiens (human): 4133Help
Entry
4133              CDS       T01001                                 

Gene name
MAP2, MAP2A, MAP2B, MAP2C
Definition
(RefSeq) microtubule associated protein 2
  KO
K10430  
microtubule-associated protein 2
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     4133 (MAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q34-q35
AA seq 1827 aa AA seqDB search
MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
AALPLAAEETANLPPSPPPSPASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEK
ESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQK
TEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPA
TAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHT
FSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMR
VDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMF
TIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGR
GHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIEKVKATGEEST
QAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRL
DTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLS
SVPEIAEVEPSKKVEQGLDFAVQGQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTP
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDE
NSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTP
SYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV
GSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
GSINLLESPQLATLAEDVTAALAKQGL
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaacggaaagatgaagcaaaggcacctcactggacctcagcaccgctaaca
gaggcatctgcacactcacatccacctgagattaaggatcaaggcggagcaggggaagga
cttgtccgaagcgccaatggattcccatacagggaggatgaagagggtgcctttggagag
catgggtcacagggcacctattcaaataccaaagagaatgggatcaacggagagctgacc
tcagctgacagagaaacagcagaggaggtgtctgcaaggatagttcaagtagtcactgct
gaggctgtagcagtcctgaaaggtgaacaagagaaagaagctcaacataaagaccagact
gcagctctgcctttagcagctgaagaaacagctaatctgcctccttctccacccccatca
cctgcctcagaacagactgtcacagtggaggaagatttacttacagcctcgaagatggag
ttccacgatcaacaggaattgactccctctacagctgagccttcagaccagaaggaaaag
gagtcagagaagcaaagtaagcctggtgaagaccttaaacatgctgccttagtttctcag
ccagagacaactaaaacttaccctgataaaaaggacatgcaaggcacggaagaagaaaaa
gcacccctagctttgtttgggcacactcttgttgccagcctggaagacatgaaacagaag
acagaaccaagccttgtagtacctggcattgacctccctaaagagcctccaactccaaaa
gaacaaaaggactggttcatcgaaatgccaacggaagcaaaaaaggatgagtggggttta
gttgcccccatatctcctggccctctgactcccatgagggaaaaagatgtatttgatgat
atcccaaaatgggaagggaaacagtttgattctcccatgccaagtccctttcaaggggga
agcttcactcttcctttagatgtcatgaagaatgaaatagttacagaaacatcgcccttt
gcccctgcctttttacagccagatgacaaaaaatctctgcaacaaaccagtggcccagct
actgccaaagatagttttaaaattgaagagccccatgaggctaaacctgacaaaatggca
gaagcaccaccctcagaggcaatgaccttacccaaagatgctcacattccagttgtagaa
gaacatgttatggggaaagttttagaggaagaaaaggaggccataaatcaagagactgtg
cagcaaagggatactttcacccccagtggacaggaacctatacttactgaaaaggaaact
gagctgaagcttgaagaaaaaaccaccatttctgacaaagaagctgtgccaaaagagagt
aaacccccaaaacctgcagatgaagaaataggcataattcagacctccacagagcacact
ttctcagaacagaaagaccaagagcctaccacagatatgttgaaacaggactcgttccct
gtaagtttggagcaagcagttacagattcagccatgacctctaaaacactggagaaagcc
atgaccgaaccatctgcattaattgaaaagagctcaattcaggaactttttgaaatgaga
gttgatgacaaagataagattgaaggagttggagctgcaacatcagctgagcttgatatg
ccattttatgaagataaatcaggaatgtccaagtactttgaaacatctgccttgaaagaa
gaagcaacaaaaagcattgagccaggcagtgattactatgaactgagtgacactagagaa
agtgtccatgagtctattgataccatgtctcccatgcataaaaatggtgacaaggagttt
caaacaggaaaagaatcccagcccagtcctccagcacaagaagcagggtacagcactctc
gcacagagttatccatcagatttacctgaagaacccagttctcctcaagaaagaatgttc
actattgatccaaaagtgtatggagagaaaagggacctccacagtaagaataaggatgat
ttgacccttagcaggagtttaggacttggtggtaggtctgcaatagaacaaagaagcatg
tcaatcaatttgccgatgtcttgcctagattccatagcccttggatttaactttggtcgg
ggacatgatctttctcctctggcttccgatattctaaccaacactagtggaagtatggat
gaaggggatgattaccttccagccaccacacctgcactggagaaagccccttgcttccct
gtagaaagcaaagaggaagaacagatagagaaagtaaaagctactggagaagaaagtact
caagcggagatatcatgtgagtctcctttcctagccaaagatttttacaaaaatggtact
gtcatggcacctgaccttcctgaaatgctagatctggcaggcacaaggtcaagattggct
tctgtgagtgcagatgctgaggttgccaggaggaaatcagtcccatcagagactgtggtt
gaggatagtcgtactggcttgcccccggtaactgatgaaaaccatgtcattgtaaaaacg
gacagtcagctcgaagacctgggctactgtgtgttcaataagtacacagtcccattgcca
tcacctgttcaagacagtgagaatttatcaggggagagtggtaccttttacgaaggcact
gatgataaagttcgaagagatttggccacagacctttcactgattgaagtgaaactggca
gcagccggaagagtcaaagatgagttcagtgttgacaaagaagcatccgcgcatatctct
ggtgacaaatcaggactgagtaaggagtttgaccaagagaagaaagctaatgataggttg
gatactgtactagaaaagagtgaagaacatgctgattcaaaagaacatgccaagaaaact
gaagaggctggtgatgaaatagaaacattcggattaggagtaacctatgagcaagctttg
gccaaagatttgtcaataccaacagatgcatcctctgagaaagcagagaagggtcttagt
tcagtgccagagatagctgaggtagaaccatccaaaaaggtggaacaaggtctggatttt
gctgtccagggtcaactagatgttaaaattagtgactttggacagatggcttcagggcta
aacatagatgatagaagggcaacagagctaaaacttgaggctacacaggacatgaccccc
tcatccaaagcaccgcaggaggcagatgcatttatgggtgttgagtctggccacatgaaa
gaaggcactaaagttagtgagacagaagtcaaagagaaggtggccaagcctgacttggtg
caccaggaggctgtagacaaggaggagtcctatgaatctagtggtgagcatgaaagtctc
accatggagtccttgaaagctgatgagggcaagaaggaaacatctccagaatcatctcta
attcaagatgagattgccgtcaaattgtcagtggaaataccttgcccacctgctgtttca
gaggctgatttagccacagatgagagagctgatgtccagatggaatttattcaggggcca
aaagaagaaagcaaagagaccccagatatatccatcacgccttctgatgttgcagagcca
ttgcatgaaacgatcgtatctgaaccagcagagattcagagtgaggaagaagagatagaa
gcccagggagaatatgataaactgctcttccgctcagacacccttcagataactgacctg
ggtgtctcaggtgccagggaggaatttgtggagacctgcccaagtgaacacaaaggagtg
attgagtctgttgtgaccatcgaggatgatttcatcactgtagtgcaaaccacaactgat
gaaggggagtcagggtcccacagcgtgcgttttgcagccctagagcagcctgaggtggaa
aggagaccatctcctcatgatgaagaagagtttgaagtagaagaggcagctgaagcccag
gcagaacccaaagatggttccccagaggctccagcttcccctgagagagaagaggttgca
ctttctgaatataagacagaaacctatgacgattacaaagatgagaccaccattgacgac
tccatcatggacgctgacagcctctgggtggacactcaagatgatgataggagcatcatg
acagaacagttagaaactattcctaaagaggagaaagctgaaaaggaagctcggagatca
tctcttgagaaacatagaaaagaaaagccttttaaaaccgggagaggcagaatttccact
cctgaaagaaaagtagctaaaaaggaacctagcacagtctccagagatgaagtgagaagg
aaaaaagcagtttataagaaggctgaacttgctaaaaaaacagaagttcaggcccactct
ccctccaggaaattcattttaaaacctgctatcaaatatactagaccaactcatctctcc
tgtgttaagcggaaaaccacagcagcaggtggggaatcagctctggctcccagtgtattt
aaacaggcaaaggacaaagtctctgacggagtaaccaagagcccagaaaagcgctcttct
ctcccaagaccttcctccattctccctcctcggcgaggtgtgtcaggagacagagatgag
aattccttctctctcaacagttctatctcttcttcagcacggcggaccaccaggtcagag
ccaattcgcagagcagggaagagtggtacctcaacacccactacccctgggtctactgcc
atcactcctggcaccccaccaagttattcttcacgcacaccaggcactcctggaacccct
agctatcccaggacccctcacacaccaggaacccccaagtctgccatcttggtgccgagt
gagaagaaggtcgccatcatacgtactcctccaaaatctcctgcgactcccaagcagctt
cggcttattaaccaaccactgccagacctgaagaatgtcaaatccaaaatcggatcaaca
gacaacatcaaataccagcctaaaggggggcaggtacaaattgttaccaagaaaatagac
ctaagccatgtgacatccaaatgtggctctctgaagaacatccgccacaggccaggtggc
ggacgtgtgaaaattgagagtgtaaaactagatttcaaagaaaaggcccaagctaaagtt
ggttctcttgataatgctcatcatgtacctggaggtggtaatgtcaagattgacagccaa
aagttgaacttcagagagcatgctaaagcccgtgtggaccatggggctgagatcattaca
cagtccccaggcagatccagcgtggcatcaccccgacgactcagcaatgtctcctcgtct
ggaagcatcaacctgctcgaatctcctcagcttgccactttggctgaggatgtcactgct
gcactcgctaagcagggcttgtga

DBGET integrated database retrieval system