KEGG   Homo sapiens (human): 4137Help
Entry
4137              CDS       T01001                                 

Gene name
MAPT, DDPAC, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, PPP1R103, TAU
Definition
(RefSeq) microtubule associated protein tau
  KO
K04380  
microtubule-associated protein tau
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Alzheimer's disease
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00077  
Progressive supranuclear palsy (PSP)
H00078  
Frontotemporal lobar degeneration (FTLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4137 (MAPT)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4137 (MAPT)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4137 (MAPT)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     4137 (MAPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.1
AA seq 758 aa AA seqDB search
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccccgccaggagttcgaagtgatggaagatcacgctgggacgtacgggttg
ggggacaggaaagatcaggggggctacaccatgcaccaagaccaagagggtgacacggac
gctggcctgaaagaatctcccctgcagacccccactgaggacggatctgaggaaccgggc
tctgaaacctctgatgctaagagcactccaacagcggaagatgtgacagcacccttagtg
gatgagggagctcccggcaagcaggctgccgcgcagccccacacggagatcccagaagga
accacagctgaagaagcaggcattggagacacccccagcctggaagacgaagctgctggt
cacgtgacccaagagcctgaaagtggtaaggtggtccaggaaggcttcctccgagagcca
ggccccccaggtctgagccaccagctcatgtccggcatgcctggggctcccctcctgcct
gagggccccagagaggccacacgccaaccttcggggacaggacctgaggacacagagggc
ggccgccacgcccctgagctgctcaagcaccagcttctaggagacctgcaccaggagggg
ccgccgctgaagggggcagggggcaaagagaggccggggagcaaggaggaggtggatgaa
gaccgcgacgtcgatgagtcctccccccaagactcccctccctccaaggcctccccagcc
caagatgggcggcctccccagacagccgccagagaagccaccagcatcccaggcttccca
gcggagggtgccatccccctccctgtggatttcctctccaaagtttccacagagatccca
gcctcagagcccgacgggcccagtgtagggcgggccaaagggcaggatgcccccctggag
ttcacgtttcacgtggaaatcacacccaacgtgcagaaggagcaggcgcactcggaggag
catttgggaagggctgcatttccaggggcccctggagaggggccagaggcccggggcccc
tctttgggagaggacacaaaagaggctgaccttccagagccctctgaaaagcagcctgct
gctgctccgcgggggaagcccgtcagccgggtccctcaactcaaagctcgcatggtcagt
aaaagcaaagacgggactggaagcgatgacaaaaaagccaagacatccacacgttcctct
gctaaaaccttgaaaaataggccttgccttagccccaaacaccccactcctggtagctca
gaccctctgatccaaccctccagccctgctgtgtgcccagagccaccttcctctcctaaa
tacgtctcttctgtcacttcccgaactggcagttctggagcaaaggagatgaaactcaag
ggggctgatggtaaaacgaagatcgccacaccgcggggagcagcccctccaggccagaag
ggccaggccaacgccaccaggattccagcaaaaaccccgcccgctccaaagacaccaccc
agctctggtgaacctccaaaatcaggggatcgcagcggctacagcagccccggctcccca
ggcactcccggcagccgctcccgcaccccgtcccttccaaccccacccacccgggagccc
aagaaggtggcagtggtccgtactccacccaagtcgccgtcttccgccaagagccgcctg
cagacagcccccgtgcccatgccagacctgaagaatgtcaagtccaagatcggctccact
gagaacctgaagcaccagccgggaggcgggaaggtgcagataattaataagaagctggat
cttagcaacgtccagtccaagtgtggctcaaaggataatatcaaacacgtcccgggaggc
ggcagtgtgcaaatagtctacaaaccagttgacctgagcaaggtgacctccaagtgtggc
tcattaggcaacatccatcataaaccaggaggtggccaggtggaagtaaaatctgagaag
cttgacttcaaggacagagtccagtcgaagattgggtccctggacaatatcacccacgtc
cctggcggaggaaataaaaagattgaaacccacaagctgaccttccgcgagaacgccaaa
gccaagacagaccacggggcggagatcgtgtacaagtcgccagtggtgtctggggacacg
tctccacggcatctcagcaatgtctcctccaccggcagcatcgacatggtagactcgccc
cagctcgccacgctagctgacgaggtgtctgcctccctggccaagcagggtttgtga

DBGET integrated database retrieval system