KEGG   Homo sapiens (human): 4140Help
Entry
4140              CDS       T01001                                 

Gene name
MARK3, CTAK1, KP78, PAR1A, Par-1a
Definition
(RefSeq) microtubule affinity regulating kinase 3
  KO
K08798  
MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4140 (MARK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   4140 (MARK3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     4140 (MARK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.32
AA seq 753 aa AA seqDB search
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNK
ADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRG
STNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRF
TWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKL
PRLSLNGVRFKRISGTSIAFKNIASKIANELKL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccactaggaccccattgccaacggtgaatgaacgagacactgaaaaccacacgtca
catggagatgggcgtcaagaagttacctctcgtaccagccgctcaggagctcggtgtaga
aactctatagcctcctgtgcagatgaacaacctcacatcggaaactacagactgttgaaa
acaatcggcaaggggaattttgcaaaagtaaaattggcaagacatatccttacaggcaga
gaggttgcaataaaaataattgacaaaactcagttgaatccaacaagtctacaaaagctc
ttcagagaagtaagaataatgaagattttaaatcatcccaatatagtgaagttattcgaa
gtcattgaaactgaaaaaacactctacctaatcatggaatatgcaagtggaggtgaagta
tttgactatttggttgcacatggcaggatgaaggaaaaagaagcaagatctaaatttaga
cagattgtgtctgcagttcaatactgccatcagaaacggatcgtacatcgagacctcaag
gctgaaaatctattgttagatgccgatatgaacattaaaatagcagatttcggttttagc
aatgaatttactgttggcggtaaactcgacacgttttgtggcagtcctccatacgcagca
cctgagctcttccagggcaagaaatatgacgggccagaagtggatgtgtggagtctgggg
gtcattttatacacactagtcagtggctcacttccctttgatgggcaaaacctaaaggaa
ctgagagagagagtattaagagggaaatacagaattcccttctacatgtctacagactgt
gaaaaccttctcaaacgtttcctggtgctaaatccaattaaacgcggcactctagagcaa
atcatgaaggacaggtggatcaatgcagggcatgaagaagatgaactcaaaccatttgtt
gaaccagagctagacatctcagaccaaaaaagaatagatattatggtgggaatgggatat
tcacaagaagaaattcaagaatctcttagtaagatgaaatacgatgaaatcacagctaca
tatttgttattggggagaaaatcttcagagctggatgctagtgattccagttctagcagc
aatctttcacttgctaaggttaggccgagcagtgatctcaacaacagtactggccagtct
cctcaccacaaagtgcagagaagtgtttcttcaagccaaaagcaaagacgctacagtgac
catgctggaccagctattccttctgttgtggcgtatccgaaaaggagtcagaccagcact
gcagatagtgacctcaaagaagatggaatttcctcccggaaatcaagtggcagtgctgtt
ggaggaaagggaattgctccagccagtcccatgcttgggaatgcaagtaatcctaataag
gcggatattcctgaacgcaagaaaagctccactgtccctagtagtaacacagcatctggt
ggaatgacacgacgaaatacttatgtttgcagtgagagaactacagctgatagacactca
gtgattcagaatggcaaagaaaacagcactattcctgatcagagaactccagttgcttca
acacacagtatcagtagtgcagccaccccagatcgaatccgcttcccaagaggcactgcc
agtcgtagcactttccacggccagccccgggaacggcgaaccgcaacatataatggccct
cctgcctctcccagcctgtcccatgaagccacaccattgtcccagactcgaagccgaggc
tccactaatctctttagtaaattaacttcaaaactcacaaggagaaacatgtcattcagg
tttatcaaaaggcttccaactgaatatgagaggaacgggagatatgagggctcaagtcgc
aatgtatctgctgagcaaaaagatgaaaacaaagaagcaaagcctcgatccctacgcttc
acctggagcatgaaaaccactagttcaatggatcccggggacatgatgcgggaaatccgc
aaagtgttggacgccaataactgcgactatgagcagagggagcgcttcttgctcttctgc
gtccacggagatgggcacgcggagaacctcgtgcagtgggaaatggaagtgtgcaagctg
ccaagactgtctctgaacggggtccggtttaagcggatatcggggacatccatagccttc
aaaaatattgcttccaaaattgccaatgagctaaagctgtaa

DBGET integrated database retrieval system