KEGG   Homo sapiens (human): 414062Help
Entry
414062            CDS       T01001                                 

Gene name
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Definition
chemokine (C-C motif) ligand 3-like 3
Orthology
K05408  
C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
Salmonella infection
Chagas disease (American trypanosomiasis)
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  Infectious diseases
   05132 Salmonella infection
    414062 (CCL3L3)
   05142 Chagas disease (American trypanosomiasis)
    414062 (CCL3L3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  414062 (CCL3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.1
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

DBGET integrated database retrieval system