KEGG   Homo sapiens (human): 414062Help
Entry
414062            CDS       T01001                                 

Gene name
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Definition
chemokine (C-C motif) ligand 3-like 3
Orthology
K05408  
C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
Salmonella infection
Chagas disease (American trypanosomiasis)
Rheumatoid arthritis
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.1
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

DBGET integrated database retrieval system