KEGG   Homo sapiens (human): 414062Help
Entry
414062            CDS       T01001                                 

Gene name
CCL3L3, 464.2, D17S1718, G0S19-2, LD78, LD78BETA, SCYA3L, SCYA3L1
Definition
(RefSeq) C-C motif chemokine ligand 3 like 3
  KO
K05408  C-C motif chemokine 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414062 (CCL3L3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    414062 (CCL3L3)
   04062 Chemokine signaling pathway
    414062 (CCL3L3)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    414062 (CCL3L3)
  Infectious diseases
   05132 Salmonella infection
    414062 (CCL3L3)
   05142 Chagas disease (American trypanosomiasis)
    414062 (CCL3L3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   414062 (CCL3L3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   414062 (CCL3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 414062
NCBI-ProteinID: NP_001001437
OMIM: 609468
HGNC: 30554
Ensembl: ENSG00000276085
Vega: OTTHUMG00000188419
UniProt: P16619
Position
17q12
AA seq 93 aa AA seqDB search
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctcctctgcaccatggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctacacctcc
cgacagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaag
cccagtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
tgggtccagaaatacgtcagtgacctggagctgagtgcctga

DBGET integrated database retrieval system