KEGG   Homo sapiens (human): 4141Help
Entry
4141              CDS       T01001                                 

Gene name
MARS, METRS, MRS, MTRNS
Definition
methionyl-tRNA synthetase (EC:6.1.1.10)
Orthology
K01874  
methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H01367  
Infantile liver failure
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hsa00450]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 900 aa AA seqDB search
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagtgatggcgtcccgggttgcttgccggtgctggccgccgccggg
agagcccggggcagagcagaggtgctcatcagcactgtaggcccggaagattgtgtggtc
ccgttcctgacccggcctaaggtccctgtcttgcagctggatagcggcaactacctcttc
tccactagtgcaatctgccgatatttttttttgttatctggctgggagcaagatgacctc
actaaccagtggctggaatgggaagcgacagagctgcagccagctttgtctgctgccctg
tactatttagtggtccaaggcaagaagggggaagatgttcttggttcagtgcggagagcc
ctgactcacattgaccacagcttgagtcgtcagaactgtcctttcctggctggggagaca
gaatctctagccgacattgttttgtggggagccctatacccattactgcaagatcccgcc
tacctccctgaggagctgagtgccctgcacagctggttccagacactgagtacccaggaa
ccatgtcagcgagctgcagagactgtactgaaacagcaaggtgtcctggctctccggcct
tacctccaaaagcagccccagcccagccccgctgagggaagggctgtcaccaatgagcct
gaggaggaggagctggctaccctatctgaggaggagattgctatggctgttactgcttgg
gagaagggcctagaaagtttgcccccgctgcggccccagcagaatccagtgttgcctgtg
gctggagaaaggaatgtgctcatcaccagtgccctcccttacgtcaacaatgtcccccac
cttgggaacatcattggttgtgtgctcagtgccgatgtctttgccaggtactctcgcctc
cgccagtggaacaccctctatctgtgtgggacagatgagtatggtacagcaacagagacc
aaggctctggaggagggactaaccccccaggagatctgcgacaagtaccacatcatccat
gctgacatctaccgctggtttaacatttcgtttgatatttttggtcgcaccaccactcca
cagcagaccaaaatcacccaggacattttccagcagttgctgaaacgaggttttgtgctg
caagatactgtggagcaactgcgatgtgagcactgtgctcgcttcctggctgaccgcttc
gtggagggcgtgtgtcccttctgtggctatgaggaggctcggggtgaccagtgtgacaag
tgtggcaagctcatcaatgctgtcgagcttaagaagcctcagtgtaaagtctgccgatca
tgccctgtggtgcagtcgagccagcacctgtttctggacctgcctaagctggagaagcga
ctggaggagtggttggggaggacattgcctggcagtgactggacacccaatgcccagttt
atcacccgttcttggcttcgggatggcctcaagccacgctgcataacccgagacctcaaa
tggggaacccctgtacccttagaaggttttgaagacaaggtattctatgtctggtttgat
gccactattggctatctgtccatcacagccaactacacagaccagtgggagagatggtgg
aagaacccagagcaagtggacctgtatcagttcatggccaaagacaatgttcctttccat
agcttagtctttccttgctcagccctaggagctgaggataactataccttggtcagccac
ctcattgctacagagtacctgaactatgaggatgggaaattctctaagagccgcggtgtg
ggagtgtttggggacatggcccaggacacggggatccctgctgacatctggcgcttctat
ctgctgtacattcggcctgagggccaggacagtgctttctcctggacggacctgctgctg
aagaataattctgagctgcttaacaacctgggcaacttcatcaacagagctgggatgttt
gtgtctaagttctttgggggctatgtgcctgagatggtgctcacccctgatgatcagcgc
ctgctggcccatgtcaccctggagctccagcactatcaccagctacttgagaaggttcgg
atccgggatgccttgcgcagtatcctcaccatatctcgacatggcaaccaatatattcag
gtgaatgagccctggaagcggattaaaggcagtgaggctgacaggcaacgggcaggaaca
gtgactggcttggcagtgaatatagctgccttgctctctgtcatgcttcagccttacatg
cccacggttagtgccacaatccaggcccagctgcagctcccacctccagcctgcagtatc
ctgctgacaaacttcctgtgtaccttaccagcaggacaccagattggcacagtcagtccc
ttgttccaaaaattggaaaatgaccagattgaaagtttaaggcagcgctttggagggggc
caggcaaaaacgtccccgaagccagcagttgtagagactgttacaacagccaagccacag
cagatacaagcgctgatggatgaagtgacaaaacaaggaaacattgtccgagaactgaaa
gcacaaaaggcagacaagaacgaggttgctgcggaggtggcgaaactcttggatctaaag
aaacagttggctgtagctgaggggaaaccccctgaagcccctaaaggcaagaagaaaaag
taa

DBGET integrated database retrieval system