KEGG   Homo sapiens (human): 4142Help
Entry
4142              CDS       T01001                                 

Gene name
MAS1, MAS, MGRA
Definition
MAS1 proto-oncogene, G protein-coupled receptor
Orthology
K04303  
MAS1 oncogene
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4142 (MAS1)
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    4142 (MAS1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Mas proto-oncogene & Mas-related (MRGs)
    4142 (MAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.3-q26
AA seq 325 aa AA seqDB search
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
RAFKDEMQPRRQKDNCNTVTVETVV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatgggtcaaacgtgacatcatttgttgttgaggaacccacgaacatctcaactggc
aggaacgcctcagtcgggaatgcacatcggcaaatccccatcgtgcactgggtcattatg
agcatctccccagtggggtttgttgagaatgggattctcctctggttcctgtgcttccgg
atgagaagaaatcccttcactgtctacatcacccacctgtctatcgcagacatctcactg
ctcttctgtattttcatcttgtctatcgactatgctttagattatgagctttcttctggc
cattactacacaattgtcacattatcagtgacttttctgtttggctacaacacgggcctc
tatctgctgacggccattagtgtggagaggtgcctgtcagtcctttaccccatctggtac
cgatgccatcgccccaagtaccagtcggcattggtctgtgcccttctgtgggctctttct
tgcttggtgaccaccatggagtatgtcatgtgcatcgacagagaagaagagagtcactct
cggaatgactgccgagcagtcatcatctttatagccatcctgagcttcctggtcttcacg
cccctcatgctggtgtccagcaccatcttggtcgtgaagatccggaagaacacgtgggct
tcccattcctccaagctttacatagtcatcatggtcaccatcattatattcctcatcttc
gctatgcccatgagactcctttacctgctgtactatgagtattggtcgacctttgggaac
ctacaccacatttccctgctcttctccacaatcaacagtagcgccaaccctttcatttac
ttctttgtgggaagcagtaagaagaagagattcaaggagtccttaaaagttgttctgacc
agggctttcaaagatgaaatgcaacctcggcgccagaaagacaattgtaatacggtcaca
gttgagactgtcgtctaa

DBGET integrated database retrieval system