KEGG   Homo sapiens (human): 4145Help
Entry
4145              CDS       T01001                                 

Gene name
MATK, CHK, CTK, HHYLTK, HYL, HYLTK, Lsk
Definition
megakaryocyte-associated tyrosine kinase (EC:2.7.10.2)
Orthology
K08888  
megakaryocyte-associated tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4145 (MATK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     4145 (MATK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Csk family
   4145 (MATK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 508 aa AA seqDB search
MQGHFPAERREGRPRRGTRGQQQLLVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEH
TRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSL
MPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLT
IDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGA
QIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQG
LYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNIL
VSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFS
YGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLA
RELRSAGAPASVSGQDADGSTSPRSQEP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagggacatttccctgctgaacgaagagaaggcagacctcggcgagggacccgtggt
cagcagcagcttctggtgagcccccgcttcctccgagcctggcacccccctcccgtctca
gccaggatgccaacgaggcgctgggccccgggcacccagtgtatcaccaaatgcgagcac
acccgccccaagccaggggagctggccttccgcaagggcgacgtggtcaccatcctggag
gcctgcgagaacaagagctggtaccgcgtcaagcaccacaccagtggacaggaggggctg
ctggcagctggggcgctgcgggagcgggaggccctctccgcagaccccaagctcagcctc
atgccgtggttccacgggaagatctcgggccaggaggctgtccagcagctgcagcctccc
gaggatgggctgttcctggtgcgggagtccgcgcgccaccccggcgactacgtcctgtgc
gtgagctttggccgcgacgtcatccactaccgcgtgctgcaccgcgacggccacctcaca
atcgatgaggccgtgttcttctgcaacctcatggacatggtggagcattacagcaaggac
aagggcgctatctgcaccaagctggtgagaccaaagcggaaacacgggaccaagtcggcc
gaggaggagctggccagggcgggctggttactgaacctgcagcatttgacattgggagca
cagatcggagagggagagtttggagctgtcctgcagggtgagtacctggggcaaaaggtg
gccgtgaagaatatcaagtgtgatgtgacagcccaggccttcctggacgagacggccgtc
atgacgaagatgcaacacgagaacctggtgcgtctcctgggcgtgatcctgcaccagggg
ctgtacattgtcatggagcacgtgagcaagggcaacctggtgaactttctgcggacccgg
ggtcgagccctcgtgaacaccgctcagctcctgcagttttctctgcacgtggccgagggc
atggagtacctggagagcaagaagcttgtgcaccgcgacctggccgcccgcaacatcctg
gtctcagaggacctggtggccaaggtcagcgactttggcctggccaaagccgagcggaag
gggctagactcaagccggctgcccgtcaagtggacggcgcccgaggctctcaaacacggg
aagttcaccagcaagtcggatgtctggagttttggggtgctgctctgggaggtcttctca
tatggacgggctccgtaccctaaaatgtcactgaaagaggtgtcggaggccgtggagaag
gggtaccgcatggaaccccccgagggctgtccaggccccgtgcacgtcctcatgagcagc
tgctgggaggcagagcccgcccgccggccacccttccgcaaactggccgagaagctggcc
cgggagctacgcagtgcaggtgccccagcctccgtctcagggcaggacgccgacggctcc
acctcgccccgaagccaggagccctga

DBGET integrated database retrieval system