KEGG   Homo sapiens (human): 4155Help
Entry
4155              CDS       T01001                                 

Gene name
MBP
Definition
(RefSeq) myelin basic protein
  KO
K17269  
myelin basic protein
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4155 (MBP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   4155 (MBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q23
AA seq 304 aa AA seqDB search
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG
GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG
RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
MARR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccacgcaggcaaacgagaattaaatgccgagaaggccagtacgaatagtgaa
actaacagaggagaatctgaaaaaaagagaaacctgggtgaactttcacggacaacctca
gaggacaacgaagtgttcggagaggcagatgcgaaccagaacaatgggacctcctctcag
gacacagcggtgactgactccaagcgcacagcggacccgaagaatgcctggcaggatgcc
cacccagctgacccagggagccgcccccacttgatccgcctcttttcccgagatgccccg
gggagggaggacaacaccttcaaagacaggccctctgagtccgacgagctccagaccatc
caagaagacagtgcagccacctccgagagcctggatgtgatggcgtcacagaagagaccc
tcccagaggcacggatccaagtacctggccacagcaagtaccatggaccatgccaggcat
ggcttcctcccaaggcacagagacacgggcatccttgactccatcgggcgcttctttggc
ggtgacaggggtgcgcccaagcggggctctggcaaggactcacaccacccggcaagaact
gctcactacggctccctgccccagaagtcacacggccggacccaagatgaaaaccccgta
gtccacttcttcaagaacattgtgacgcctcgcacaccacccccgtcgcagggaaagggg
agaggactgtccctgagcagatttagctggggggccgaaggccagagaccaggatttggc
tacggaggcagagcgtccgactataaatcggctcacaagggattcaagggagtcgatgcc
cagggcacgctttccaaaatttttaagctgggaggaagagatagtcgctctggatcaccc
atggctagacgctga

DBGET integrated database retrieval system