KEGG   Homo sapiens (human): 4157Help
Entry
4157              CDS       T01001                                 

Gene name
MC1R, CMM5, MSH-R, SHEP2
Definition
(RefSeq) melanocortin 1 receptor
  KO
K04199  
melanocortin 1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Melanogenesis
Drug target
Alsactide: 
Bremelanotide: 
Corticotropin (DG00492): 
Giractide (DG01344): 
Seractide acetate: 
Tetracosactide (DG00493): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4157 (MC1R)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    4157 (MC1R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Melanocortin
    4157 (MC1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 317 aa AA seqDB search
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagggatcccagagaagacttctgggctccctcaactccacccccacagcc
atcccccagctggggctggctgccaaccagacaggagcccggtgcctggaggtgtccatc
tctgacgggctcttcctcagcctggggctggtgagcttggtggagaacgcgctggtggtg
gccaccatcgccaagaaccggaacctgcactcacccatgtactgcttcatctgctgcctg
gccttgtcggacctgctggtgagcgggagcaacgtgctggagacggccgtcatcctcctg
ctggaggccggtgcactggtggcccgggctgcggtgctgcagcagctggacaatgtcatt
gacgtgatcacctgcagctccatgctgtccagcctctgcttcctgggcgccatcgccgtg
gaccgctacatctccatcttctacgcactgcgctaccacagcatcgtgaccctgccgcgg
gcgcggcgagccgttgcggccatctgggtggccagtgtcgtcttcagcacgctcttcatc
gcctactacgaccacgtggccgtcctgctgtgcctcgtggtcttcttcctggctatgctg
gtgctcatggccgtgctgtacgtccacatgctggcccgggcctgccagcacgcccagggc
atcgcccggctccacaagaggcagcgcccggtccaccagggctttggccttaaaggcgct
gtcaccctcaccatcctgctgggcattttcttcctctgctggggccccttcttcctgcat
ctcacactcatcgtcctctgccccgagcaccccacgtgcggctgcatcttcaagaacttc
aacctctttctcgccctcatcatctgcaatgccatcatcgaccccctcatctacgccttc
cacagccaggagctccgcaggacgctcaaggaggtgctgacatgctcctggtga

DBGET integrated database retrieval system