KEGG   Homo sapiens (human): 4158Help
Entry
4158              CDS       T01001                                 

Gene name
MC2R, ACTHR
Definition
(RefSeq) melanocortin 2 receptor
  KO
K04200  
melanocortin 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Aldosterone synthesis and secretion
Disease
H00033  
Adrenal carcinoma
H00256  
Familial glucocorticoid deficiency (FGD)
Drug target
Alsactide: 
Bremelanotide: 
Corticotropin (DG00492): 
Giractide (DG01344): 
Seractide acetate: 
Tetracosactide (DG00493): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    4158 (MC2R)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4158 (MC2R)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    4158 (MC2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Melanocortin
    4158 (MC2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01718(Tclin)
UniProt: 
Position
18p11.21
AA seq 297 aa AA seqDB search
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMY
FFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFS
LSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTS
LFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVL
LMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacattatcaactcgtatgaaaacatcaacaacacagcaagaaataattccgac
tgtcctcgtgtggttttgccggaggagatatttttcacaatttccattgttggagttttg
gagaatctgatcgtcctgctggctgtgttcaagaataagaatctccaggcacccatgtac
tttttcatctgtagcttggccatatctgatatgctgggcagcctatataagatcttggaa
aatatcctgatcatattgagaaacatgggctatctcaagccacgtggcagttttgaaacc
acagccgatgacatcatcgactccctgtttgtcctctccctgcttggctccatcttcagc
ctgtctgtgattgctgcggaccgctacatcaccatcttccacgcactgcggtaccacagc
atcgtgaccatgcgccgcactgtggtggtgcttacggtcatctggacgttctgcacgggg
actggcatcaccatggtgatcttctcccatcatgtgcccacagtgatcaccttcacgtcg
ctgttcccgctgatgctggtcttcatcctgtgcctctatgtgcacatgttcctgctggct
cgatcccacaccaggaagatctccaccctccccagagccaacatgaaaggggccatcaca
ctgaccatcctgctcggggtcttcatcttctgctgggccccctttgtgcttcatgtcctc
ttgatgacattctgcccaagtaacccctactgcgcctgctacatgtctctcttccaggtg
aacggcatgttgatcatgtgcaatgccgtcattgaccccttcatatatgccttccggagc
ccagagctcagggacgcattcaaaaagatgatcttctgcagcaggtactggtag

DBGET integrated database retrieval system