KEGG   Homo sapiens (human): 4159Help
Entry
4159              CDS       T01001                                 

Gene name
MC3R, BMIQ9, MC3, MC3-R, OB20, OQTL
Definition
melanocortin 3 receptor
Orthology
K04201  
melanocortin 3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Corticotropin: 
Tetracosactide: 
Alsactide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4159 (MC3R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Melanocortin
    4159 (MC3R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.2-q13.3
AA seq 323 aa AA seqDB search
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttcgtgctgcctgccctctgttcagccaacactgcctaatggctcggagcac
ctccaagcccctttcttcagcaaccagagcagcagcgccttctgtgagcaggtcttcatc
aagcccgaggttttcctgtctctgggcatcgtcagtctgctggaaaacatcctggttatc
ctggccgtggtcaggaacggcaacctgcactccccgatgtacttctttctctgcagcctg
gcggtggccgacatgctggtaagtgtgtccaatgccctggagaccatcatgatcgccatc
gtccacagcgactacctgaccttcgaggaccagtttatccagcacatggacaacatcttc
gactccatgatctgcatctccctggtggcctccatctgcaacctcctggccatcgccgtc
gacaggtacgtcaccatcttttacgcgctccgctaccacagcatcatgaccgtgaggaag
gccctcaccttgatcgtggccatctgggtctgctgcggcgtctgtggcgtggtgttcatc
gtctactcggagagcaaaatggtcattgtgtgcctcatcaccatgttcttcgccatgatg
ctcctcatgggcaccctctacgtgcacatgttcctctttgcgcggctgcacgtcaagcgc
atagcagcactgccacctgccgacggggtggccccacagcaacactcatgcatgaagggg
gcagtcaccatcaccattctcctgggcgtgttcatcttctgctgggcccccttcttcctc
cacctggtcctcatcatcacctgccccaccaacccctactgcatctgctacactgcccac
ttcaacacctacctggtcctcatcatgtgcaactccgtcatcgacccactcatctacgct
ttccggagcctggaattgcgcaacacctttagggagattctctgtggctgcaacggcatg
aacttgggatag

DBGET integrated database retrieval system