KEGG   Homo sapiens (human): 4161Help
Entry
4161              CDS       T01001                                 

Gene name
MC5R, MC2
Definition
(RefSeq) melanocortin 5 receptor
  KO
K04203  
melanocortin 5 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Alsactide: 
Bremelanotide: 
Corticotropin (DG00492): 
Giractide (DG01344): 
Seractide acetate: 
Tetracosactide (DG00493): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4161 (MC5R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pituitary hormone
   Melanocortin
    4161 (MC5R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P33032(Tchem)
UniProt: 
Position
18p11.21
AA seq 325 aa AA seqDB search
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctcatttcacctgcatttcttggatctcaacctgaatgccacagagggcaac
ctttcaggacccaatgtcaaaaacaagtcttcaccatgtgaagacatgggcattgctgtg
gaggtgtttctcactctgggtgtcatcagcctcttggagaacatcttggtcataggggcc
atagtgaagaacaaaaacctgcactcccccatgtacttcttcgtgtgcagcctggcagtg
gcggacatgctggtgagcatgtccagtgcctgggagaccatcaccatctacctactcaac
aacaagcacctagtgatagcagacgcctttgtgcgccacattgacaatgtgtttgactcc
atgatctgcatttccgtggtggcatccatgtgcagcttactggccattgcagtggatagg
tacgtcaccatcttctacgccctgcgctaccaccacatcatgacggcgaggcgctcaggg
gccatcatcgccggcatctgggctttctgcacgggctgcggcattgtcttcatcctgtac
tcagaatccacctacgtcatcctgtgcctcatctccatgttcttcgctatgctgttcctc
ctggtgtctctgtacatacacatgttcctcctggcgcggactcacgtcaagcggatcgcg
gctctgcccggggccagctctgcgcggcagaggaccagcatgcagggcgcggtcaccgtc
accatgctgctgggcgtgtttaccgtgtgctgggccccgttcttccttcatctcacttta
atgctttcttgccctcagaacctctactgctctcgcttcatgtctcacttcaatatgtac
ctcatactcatcatgtgtaattccgtgatggaccctctcatatatgccttccgcagccaa
gagatgcggaagacctttaaggagattatttgctgccgtggtttcaggatcgcctgcagc
tttcccagaagggattaa

DBGET integrated database retrieval system