KEGG   Homo sapiens (human): 4166Help
Entry
4166              CDS       T01001                                 

Gene name
CHST6, MCDC1
Definition
carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6
Orthology
K09671  
carbohydrate 6-sulfotransferase 6 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - keratan sulfate
Disease
H00954  
Macular corneal dystrophy (MCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    4166 (CHST6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     4166 (CHST6)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   4166 (CHST6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
16q22
AA seq 395 aa AA seqDB search
MWLPRVSSTAVTALLLAQTFLLLFLVSRPGPSSPAGGEARVHVLVLSSWRSGSSFVGQLF
NQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLVRSVFLCDMDVFDAYLPWRRNLSDL
FQWAVSRALCSPPACSAFPRGAISSEAVCKPLCARQSFTLAREACRSYSHVVLKEVRFFN
LQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPGLR
VVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREPLAEIRALYAFTGLSLTPQLE
AWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHALPFAKIRRVQELCAGALQLLGYRP
VYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgccgcgcgtctccagcacagcagtgaccgcgctcctcctggcgcagaccttc
ctcctcctctttctggtttcccggccagggccctcgtccccagcaggcggcgaggcgcgc
gtgcatgtgctggtgctgtcctcgtggcgctcgggctcgtccttcgtgggccaactcttc
aaccagcaccccgacgtcttctacctaatggagcccgcgtggcacgtgtggaccaccctg
tcgcagggcagcgccgcaacgctgcacatggctgtgcgcgacctggtgcgctccgtcttc
ctgtgcgacatggacgtgtttgatgcctatctgccttggcgccgcaacctgtccgacctc
ttccagtgggccgtgagccgtgcactgtgctcgccacccgcctgcagtgcctttccccga
ggcgccatcagcagcgaggccgtgtgcaagccactgtgcgcgcggcagtccttcaccctg
gcccgggaggcctgccgctcctacagccacgtggtgctcaaggaggtgcgcttcttcaac
ctgcaggtgctctacccgctgctcagcgaccccgcgctcaacctacgcatcgtgcacctg
gtgcgcgacccgcgggccgtgctgcgctcccgggagcagacagccaaggctctggcgcgt
gacaacggcatcgtgctgggcaccaacggcacgtgggtggaggccgaccccggcctgcgc
gtggtgcgcgaggtgtgccgtagccacgtacgcatcgccgaggccgccacactcaagccg
ccaccctttctgcgcggccgctaccgcctggtgcgcttcgaggacctggcgcgggagccg
ctggcagaaatccgtgcgctctacgccttcactgggctcagtctcacgccacagctcgag
gcctggatccataacatcacccacggatctggacctggtgcgcgccgcgaagccttcaag
acttcgtccaggaatgcgctcaacgtctcccaggcctggcgccatgcgctgccctttgcc
aagatccgccgcgtgcaggaactgtgcgctggtgcgctgcagctgctgggctaccggcct
gtgtactctgaggacgagcagcgcaacctcgcccttgatctggtgctgccacgaggcctg
aacggcttcacttgggcatcatccaccgcctcgcacccccgaaattag

DBGET integrated database retrieval system