KEGG   Homo sapiens (human): 417Help
Entry
417               CDS       T01001                                 

Gene name
ART1, ART2, ARTC1, CD296, RT6
Definition
ADP-ribosyltransferase 1 (EC:2.4.2.31)
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     417 (ART1)
Cellular antigens [BR:hsa04090]
 Proteins
  417 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15
AA seq 327 aa AA seqDB search
MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAA
LPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRG
VHGLRFRPAGPRATVRLGGFASASLKHVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQS
PLSAVWSLLLLLWFLVVRAFPDGPGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcctgctatgatgtctctgcttcttgtgtctgtgggcctcatggaagcactt
caggcccagagccaccccatcacacgacgagacctcttctctcaagagattcagctggac
atggccctggcctcctttgatgaccagtacgctggctgtgctgctgccatgacagctgct
ctcccggatctcaaccacacggagttccaggccaaccaggtgtatgcagacagctggaca
ctggcaagcagccaatggcaggagcgtcaggccaggtggccagagtggagtctcagcccc
acccgtccatccccgccacccctgggcttccgcgatgagcatggggtggccctcctggcc
tacacagccaacagccccctgcacaaggagttcaatgcagccgtgcgtgaggcgggccgc
tcccgggcccactacctccaccacttctccttcaagacactccatttcctgctgactgag
gccctgcagctcctgggcagcggccagcgtccaccccggtgccaccaggtgttccgaggt
gtgcacggcctgcgcttccggccagcagggccccgggccaccgtgaggctggggggcttt
gcttctgcctccctgaagcatgttgcagcccagcagtttggtgaggacaccttcttcggc
atctggacctgccttggggcccctatcaagggctactccttcttccctggagaggaagag
gtgctgatccccccctttgagaccttccaagtgatcaatgccagcagactggcccagggc
cccgcccgcatctacctccgagccctgggcaagcacagcacctacaactgcgagtacatc
aaagacaagaagtgcaagtctgggccttgccatctggataattcagccatgggtcagagc
cccctctctgcagtctggtctttgctgctgctgctctggttcctcgtggtgagggccttt
ccagatggtccaggcctcctttga

DBGET integrated database retrieval system