KEGG   Homo sapiens (human): 4170Help
Entry
4170              CDS       T01001                                 

Gene name
MCL1, BCL2L3, EAT, MCL1-ES, MCL1L, MCL1S, Mcl-1, TM, bcl2-L-3, mcl1/EAT
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  
myeloid leukemia cell differntiation protein MCL-1
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
MicroRNAs in cancer
Drug target
Navitoclax: 
Navitoclax dihydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    4170 (MCL1)
   04151 PI3K-Akt signaling pathway
    4170 (MCL1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4170 (MCL1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4170 (MCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 350 aa AA seqDB search
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggggccggcagcggcggcgccacccgcccgggagggcgacttttggctacggagaag
gaggcctcggcccggcgagagatagggggaggggaggccggcgcggtgattggcggaagc
gccggcgcaagccccccgtccaccctcacgccagactcccggagggtcgcgcggccgccg
cccattggcgccgaggtccccgacgtcaccgcgacccccgcgaggctgcttttcttcgcg
cccacccgccgcgcggcgccgcttgaggagatggaagccccggccgctgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgccgctgctggagttggtcggggaatctggtaataacaccagtacggacgggtcacta
ccctcgacgccgccgccagcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggccaccggcgccaaggacacaaagccaatgggc
aggtctggggccaccagcaggaaggcgctggagaccttacgacgggttggggatggcgtg
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtgaaatcgttgtctcgagtgatgatccatgttttcagcgacggcgtaacaaac
tggggcaggattgtgactctcatttcttttggtgcctttgtggctaaacacttgaagacc
ataaaccaagaaagctgcatcgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcaggaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system