KEGG   Homo sapiens (human): 4171Help
Entry
4171              CDS       T01001                                 

Gene name
MCM2, BM28, CCNL1, CDCL1, D3S3194, MITOTIN, cdc19
Definition
minichromosome maintenance complex component 2 (EC:3.6.4.12)
Orthology
K02540  
DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21
AA seq 904 aa AA seqDB search
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatcatcggaatccttcaccatggcatccagcccggcccagcgtcggcgaggc
aatgatcctctcacctccagccctggccgaagctcccggcgtactgatgccctcacctcc
agccctggccgtgaccttccaccatttgaggatgagtccgaggggctcctaggcacagag
gggcccctggaggaagaagaggatggagaggagctcattggagatggcatggaaagggac
taccgcgccatcccagagctggacgcctatgaggccgagggactggctctggatgatgag
gacgtagaggagctgacggccagtcagagggaggcagcagagcgggccatgcggcagcgt
gaccgggaggctggccggggcctgggccgcatgcgccgtgggctcctgtatgacagcgat
gaggaggacgaggagcgccctgcccgcaagcgccgccaggtggagcgggccacggaggac
ggcgaggaggacgaggagatgatcgagagcatcgagaacctggaggatctcaaaggccac
tctgtgcgcgagtgggtgagcatggcgggcccccggctggagatccaccaccgcttcaag
aacttcctgcgcactcacgtcgacagccacggccacaacgtcttcaaggagcgcatcagc
gacatgtgcaaagagaaccgtgagagcctggtggtgaactatgaggacttggcagccagg
gagcacgtgctggcctacttcctgcctgaggcaccggcggagctgctgcagatctttgat
gaggctgccctggaggtggtactggccatgtaccccaagtacgaccgcatcaccaaccac
atccatgtccgcatctcccacctgcctctggtggaggagctgcgctcgctgaggcagctg
catctgaaccagctgatccgcaccagtggggtggtgaccagctgcactggcgtcctgccc
cagctcagcatggtcaagtacaactgcaacaagtgcaatttcgtcctgggtcctttctgc
cagtcccagaaccaggaggtgaaaccaggctcctgtcctgagtgccagtcggccggcccc
tttgaggtcaacatggaggagaccatctatcagaactaccagcgtatccgaatccaggag
agtccaggcaaagtggcggctggccggctgccccgctccaaggacgccattctcctcgca
gatctggtggacagctgcaagccaggagacgagatagagctgactggcatctatcacaac
aactatgatggctccctcaacactgccaatggcttccctgtctttgccactgtcatccta
gccaaccacgtggccaagaaggacaacaaggttgctgtaggggaactgaccgatgaagat
gtgaagatgatcactagcctctccaaggatcagcagatcggagagaagatctttgccagc
attgctccttccatctatggtcatgaagacatcaagagaggcctggctctggccctgttc
ggaggggagcccaaaaacccaggtggcaagcacaaggtacgtggtgatatcaacgtgctc
ttgtgcggagaccctggcacagcgaagtcgcagtttctcaagtatattgagaaagtgtcc
agccgagccatcttcaccactggccagggggcgtcggctgtgggcctcacggcgtatgtc
cagcggcaccctgtcagcagggagtggaccttggaggctggggccctggttctggctgac
cgaggagtgtgtctcattgatgaatttgacaagatgaatgaccaggacagaaccagcatc
catgaggccatggagcaacagagcatctccatctcgaaggctggcatcgtcacctccctg
caggctcgctgcacggtcattgctgccgccaaccccataggagggcgctacgacccctcg
ctgactttctctgagaacgtggacctcacagagcccatcatctcacgctttgacatcctg
tgtgtggtgagggacaccgtggacccagtccaggacgagatgctggcccgcttcgtggtg
ggcagccacgtcagacaccaccccagcaacaaggaggaggaggggctggccaatggcagc
gctgctgagcccgccatgcccaacacgtatggcgtggagcccctgccccaggaggtcctg
aagaagtacatcatctacgccaaggagagggtccacccgaagctcaaccagatggaccag
gacaaggtggccaagatgtacagtgacctgaggaaagaatctatggcgacaggcagcatc
cccattacggtgcggcacatcgagtccatgatccgcatggcggaggcccacgcgcgcatc
catctgcgggactatgtgatcgaagacgacgtcaacatggccatccgcgtgatgctggag
agcttcatagacacacagaagttcagcgtcatgcgcagcatgcgcaagacttttgcccgc
tacctttcattccggcgtgacaacaatgagctgttgctcttcatactgaagcagttagtg
gcagagcaggtgacatatcagcgcaaccgctttggggcccagcaggacactattgaggtc
cctgagaaggacttggtggataaggctcgtcagatcaacatccacaacctctctgcattt
tatgacagtgagctcttcaggatgaacaagttcagccacgacctgaaaaggaaaatgatc
ctgcagcagttctga

DBGET integrated database retrieval system