KEGG   Homo sapiens (human): 4171Help
Entry
4171              CDS       T01001                                 

Gene name
MCM2, BM28, CCNL1, CDCL1, D3S3194, MITOTIN, cdc19
Definition
minichromosome maintenance complex component 2 (EC:3.6.4.12)
Orthology
K02540  
DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4171 (MCM2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4171 (MCM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4171 (MCM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21
AA seq 904 aa AA seqDB search
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatcatcggaatccttcaccatggcatccagcccggcccagcgtcggcgaggc
aatgatcctctcacctccagccctggccgaagctcccggcgtactgatgccctcacctcc
agccctggccgtgaccttccaccatttgaggatgagtccgaggggctcctaggcacagag
gggcccctggaggaagaagaggatggagaggagctcattggagatggcatggaaagggac
taccgcgccatcccagagctggacgcctatgaggccgagggactggctctggatgatgag
gacgtagaggagctgacggccagtcagagggaggcagcagagcgggccatgcggcagcgt
gaccgggaggctggccggggcctgggccgcatgcgccgtgggctcctgtatgacagcgat
gaggaggacgaggagcgccctgcccgcaagcgccgccaggtggagcgggccacggaggac
ggcgaggaggacgaggagatgatcgagagcatcgagaacctggaggatctcaaaggccac
tctgtgcgcgagtgggtgagcatggcgggcccccggctggagatccaccaccgcttcaag
aacttcctgcgcactcacgtcgacagccacggccacaacgtcttcaaggagcgcatcagc
gacatgtgcaaagagaaccgtgagagcctggtggtgaactatgaggacttggcagccagg
gagcacgtgctggcctacttcctgcctgaggcaccggcggagctgctgcagatctttgat
gaggctgccctggaggtggtactggccatgtaccccaagtacgaccgcatcaccaaccac
atccatgtccgcatctcccacctgcctctggtggaggagctgcgctcgctgaggcagctg
catctgaaccagctgatccgcaccagtggggtggtgaccagctgcactggcgtcctgccc
cagctcagcatggtcaagtacaactgcaacaagtgcaatttcgtcctgggtcctttctgc
cagtcccagaaccaggaggtgaaaccaggctcctgtcctgagtgccagtcggccggcccc
tttgaggtcaacatggaggagaccatctatcagaactaccagcgtatccgaatccaggag
agtccaggcaaagtggcggctggccggctgccccgctccaaggacgccattctcctcgca
gatctggtggacagctgcaagccaggagacgagatagagctgactggcatctatcacaac
aactatgatggctccctcaacactgccaatggcttccctgtctttgccactgtcatccta
gccaaccacgtggccaagaaggacaacaaggttgctgtaggggaactgaccgatgaagat
gtgaagatgatcactagcctctccaaggatcagcagatcggagagaagatctttgccagc
attgctccttccatctatggtcatgaagacatcaagagaggcctggctctggccctgttc
ggaggggagcccaaaaacccaggtggcaagcacaaggtacgtggtgatatcaacgtgctc
ttgtgcggagaccctggcacagcgaagtcgcagtttctcaagtatattgagaaagtgtcc
agccgagccatcttcaccactggccagggggcgtcggctgtgggcctcacggcgtatgtc
cagcggcaccctgtcagcagggagtggaccttggaggctggggccctggttctggctgac
cgaggagtgtgtctcattgatgaatttgacaagatgaatgaccaggacagaaccagcatc
catgaggccatggagcaacagagcatctccatctcgaaggctggcatcgtcacctccctg
caggctcgctgcacggtcattgctgccgccaaccccataggagggcgctacgacccctcg
ctgactttctctgagaacgtggacctcacagagcccatcatctcacgctttgacatcctg
tgtgtggtgagggacaccgtggacccagtccaggacgagatgctggcccgcttcgtggtg
ggcagccacgtcagacaccaccccagcaacaaggaggaggaggggctggccaatggcagc
gctgctgagcccgccatgcccaacacgtatggcgtggagcccctgccccaggaggtcctg
aagaagtacatcatctacgccaaggagagggtccacccgaagctcaaccagatggaccag
gacaaggtggccaagatgtacagtgacctgaggaaagaatctatggcgacaggcagcatc
cccattacggtgcggcacatcgagtccatgatccgcatggcggaggcccacgcgcgcatc
catctgcgggactatgtgatcgaagacgacgtcaacatggccatccgcgtgatgctggag
agcttcatagacacacagaagttcagcgtcatgcgcagcatgcgcaagacttttgcccgc
tacctttcattccggcgtgacaacaatgagctgttgctcttcatactgaagcagttagtg
gcagagcaggtgacatatcagcgcaaccgctttggggcccagcaggacactattgaggtc
cctgagaaggacttggtggataaggctcgtcagatcaacatccacaacctctctgcattt
tatgacagtgagctcttcaggatgaacaagttcagccacgacctgaaaaggaaaatgatc
ctgcagcagttctga

DBGET integrated database retrieval system