KEGG   Homo sapiens (human): 4172Help
Entry
4172              CDS       T01001                                 

Gene name
MCM3, HCC5, P1-MCM3, P1.h, RLFB
Definition
minichromosome maintenance complex component 3 (EC:3.6.4.12)
Orthology
K02541  
DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4172 (MCM3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4172 (MCM3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4172 (MCM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12
AA seq 818 aa AA seqDB search
MLICSQGPRLFLEVTFGGGKSSEVFAPGWSHPGNLHATLVEVVLWQRAWRVPWCWTMWSC
GRLREITWTSWTTRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKH
VSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPS
SSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAK
PGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKT
RSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA
KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDE
FDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIG
LQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATD
DPNFSQEDQQDTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYI
AEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQ
YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDF
SDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTE
SINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgcttatatgctcccaaggtccccgcctcttcctcgaggtaacctttggtggcgggaag
agttcggaagttttcgcgccggggtggagtcatcctgggaacctccacgcgactttggtg
gaggtagttctttggcagcgggcatggcgggtaccgtggtgctggacgatgtggagctgc
gggaggctcagagagattacctggacttcctggacgacgaggcttctgaacaatgccttt
gaggagctggttgccttccagcgggccttaaaggattttgtggcctccattgatgctacc
tatgccaagcagtatgaggagttctacgtaggactggaaggcagctttggctccaagcac
gtctccccgcggactcttacctcctgcttcctcagctgtgtggtctgtgtggagggcatt
gtcactaaatgttctctagttcgtcccaaagtcgtccgcagtgtccactactgtcctgct
actaagaagaccatagagcgacgttattctgatctcaccaccctggtggcctttccctcc
agctctgtctatcctaccaaggatgaggagaacaatccccttgagacagaatatggcctt
tctgtctacaaggatcaccagaccatcaccatccaggagatgccggagaaggccccagcc
ggccagctcccccgctctgtggacgtcattctggatgatgacttggtggataaagcgaag
cctggtgaccgggttcaggtggtgggaacctaccgttgccttcctggaaagaagggaggc
tacacctctgggaccttcaggactgtcctgattgcctgtaatgttaagcagatgagcaag
gatgctcagccctctttctctgctgaggatatagccaagatcaagaagttcagtaaaacc
cgatccaaggatatctttgaccagctggccaagtcattggccccaagtatccatgggcat
gactatgtcaagaaagcaatcctctgcttgctcttgggaggggtggaacgagacctagaa
aatggcagccacatccgtggggacatcaatattcttctaataggagacccatccgttgcc
aagtctcagcttctgcggtatgtgctttgcactgcaccccgagctatccccaccactggc
cggggctcctctggagtgggtctgacggctgctgtcaccacagaccaggaaacaggagag
cgccgtctggaagcaggggccatggtcctggctgaccgaggcgtggtttgcattgatgaa
tttgacaaaatgtctgacatggatcgcacagccatccatgaagtgatggagcagggtcga
gtgaccattgccaaggctggcatccatgctcggctgaatgcccgctgcagtgttttggca
gctgccaaccctgtctacggcaggtatgaccagtataagactccaatggagaacattggg
ctacaggactcactgctgtcacgatttgacttgctcttcatcatgctggatcagatggat
cctgagcaggatcgggagatctcagaccatgtccttcggatgcaccgttacagagcacct
ggggagcaggatggcgatgctatgcccttgggtagtgctgtggatatcctggccacagat
gatcccaactttagccaggaagatcagcaggacacccagatttatgagaagcatgacaac
cttctacatgggaccaagaagaaaaaggagaagatggtgagtgcagcattcatgaagaag
tacatccatgtggccaaaatcatcaagcctgtcctgacacaggagtcggccacctacatt
gcagaagagtattcacgcctgcgcagccaggatagcatgagctcagacaccgccaggaca
tctccagttacagcccgaacactggaaactctgattcgactggccacagcccatgcgaag
gcccgcatgagcaagactgtggacctgcaggatgcagaggaagctgtggagttggtccag
tatgcttactttaagaaggttctggagaaggagaagaaacgtaagaagcgaagtgaggat
gaatcagagacagaagatgaagaggagaaaagccaagaggaccaggagcagaagaggaag
agaaggaagactcgccagccagatgccaaagatggggattcatacgacccctatgacttc
agtgacacagaggaggaaatgcctcaagtacacactccaaagacggcagactcacaggag
accaaggaatcccagaaagtggagttgagtgaatccaggttgaaggcattcaaggtggcc
ctcttggatgtgttccgggaagctcatgcgcagtcaatcggcatgaatcgcctcacagaa
tccatcaaccgggacagcgaagagcccttctcttcagttgagatccaggctgctctgagc
aagatgcaggatgacaatcaggtcatggtgtctgagggcatcatcttcctcatctga

DBGET integrated database retrieval system