KEGG   Homo sapiens (human): 4173Help
Entry
4173              CDS       T01001                                 

Gene name
MCM4, CDC21, CDC54, NKCD, NKGCD, P1-CDC21, hCdc21
Definition
(RefSeq) minichromosome maintenance complex component 4 (EC:3.6.4.12)
  KO
K02212  
DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4173 (MCM4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4173 (MCM4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4173 (MCM4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4173 (MCM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11.2
AA seq 863 aa AA seqDB search
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccggcgtcgaccccgagccgccgcggcagccggcgtggaagggccaccccc
gcccagacgcctcggagtgaggatgccaggtcatctccctctcagagacgtagaggcgag
gattccacctccacgggggagttgcagccgatgccaacctcgcctggagtggacctgcag
agccctgctgcgcaggacgtgctgttttccagccctccccaaatgcattcttcagctatc
cctcttgactttgatgttagttcaccactgacatacggcactcccagctctcgggtagag
ggaaccccaagaagtggtgttaggggcacacctgtgagacagaggcctgacctgggctct
gcacagaagggcctgcaagtggatctgcagtctgacggggcagcagcagaagatatagtg
gcaagtgagcagtctctaggccaaaaacttgtgatctggggaacagatgtaaatgtggca
gcatgcaaagaaaactttcagagatttcttcagcgttttattgaccctctggctaaagaa
gaagaaaatgttggcatagatattactgaacctctatacatgcaacgacttggggagatt
aatgttattggtgagccatttttaaatgtgaactgtgaacacatcaaatcatttgacaaa
aatttgtacagacaactcatctcttacccacaggaagttattccaacttttgacatggct
gtcaatgaaatcttctttgaccgttaccctgactcaatcttagaacatcagattcaagta
agaccattcaacgcattgaagactaagaatatgagaaacctgaatccagaagacattgac
cagctcatcaccatcagcggcatggtgatcaggacatcccagctgattcccgagatgcag
gaggccttcttccagtgccaagtgtgtgcccacacgacccgggtggagatggaccgcggc
cgcattgcagagcccagtgtgtgcgggcgctgccacaccacccacagcatggcactcatc
cacaaccgctccctcttctctgacaagcagatgatcaagcttcaggagtctccggaagac
atgcctgcagggcagacaccacacacagttatcctgtttgctcacaatgatctcgttgac
aaggtccagcctggggacagagtgaatgttacaggcatctatcgagctgtgcctattcga
gtcaatccaagagtgagtaatgtgaagtctgtctacaaaacccacattgatgtcattcat
tatcggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaactt
ttttcagagaaacgtgtggaattgcttaaggaactttccaggaaaccagacatttatgag
aggcttgcttcagccttggctccaagcatttatgaacatgaagatataaagaagggaatt
ttgcttcagctctttggcgggacaaggaaggattttagtcacactggaaggggcaaattt
cgggctgagatcaacatcttgctgtgtggcgaccctggtaccagcaagtcccagctgctg
cagtacgtgtacaacctcgtccccaggggccagtacacgtctgggaagggctccagtgca
gttggcctcactgcgtacgtaatgaaagaccctgagacaaggcagctggtcctgcagaca
ggtgctcttgtcctgagtgacaacggcatctgctgtatcgatgagttcgacaagatgaat
gaaagtacaagatcggtattgcatgaagtcatggaacagcagactctgtccattgcaaag
gctgggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcccatt
gagtctcagtggaatcctaaaaaaacaaccattgaaaacatccagctgcctcatacttta
ttatcaaggtttgatttgatcttcctcttgctggaccctcaggacgaagcctatgacagg
cgtctggctcaccacctggtcgcactgtactaccagagcgaggagcaggcagaggaggag
ctcctggacatggcggtgctaaaggactacattgcctacgcgcacagcaccatcatgccg
cggctaagtgaggaagccagccaggctctcatcgaggcttatgtagacatgaggaagatt
ggcagtagccggggaatggtttctgcataccctcgacagctagagtcattaatccgctta
gcagaagcccatgctaaagtaagattgtctaacaaagttgaagccattgatgtggaagag
gccaaacgcctccatcgggaagctctgaagcagtctgcaactgatccccggactggcatc
gtggacatatctattcttactacggggatgagtgccacctctcgtaaacggaaagaagaa
ttagctgaagcattgaaaaagcttattttatctaagggcaaaacaccagctctaaaatac
cagcaactttttgaagatattcggggacaatctgacatagcaattactaaagatatgttt
gaagaagcactgcgtgccctggcagatgatgatttcctgacagtgactgggaagaccgtg
cgcttgctctga

DBGET integrated database retrieval system