KEGG   Homo sapiens (human): 4173Help
Entry
4173              CDS       T01001                                 

Gene name
MCM4, CDC21, CDC54, NKCD, NKGCD, P1-CDC21, hCdc21
Definition
minichromosome maintenance complex component 4 (EC:3.6.4.12)
Orthology
K02212  
DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4173 (MCM4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4173 (MCM4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4173 (MCM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11.2
AA seq 863 aa AA seqDB search
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccggcgtcgaccccgagccgccgcggcagccggcgtggaagggccaccccc
gcccagacgcctcggagtgaggatgccaggtcatctccctctcagagacgtagaggcgag
gattccacctccacgggggagttgcagccgatgccaacctcgcctggagtggacctgcag
agccctgctgcgcaggacgtgctgttttccagccctccccaaatgcattcttcagctatc
cctcttgactttgatgttagttcaccactgacatacggcactcccagctctcgggtagag
ggaaccccaagaagtggtgttaggggcacacctgtgagacagaggcctgacctgggctct
gcacagaagggcctgcaagtggatctgcagtctgacggggcagcagcagaagatatagtg
gcaagtgagcagtctctaggccaaaaacttgtgatctggggaacagatgtaaatgtggca
gcatgcaaagaaaactttcagagatttcttcagcgttttattgaccctctggctaaagaa
gaagaaaatgttggcatagatattactgaacctctatacatgcaacgacttggggagatt
aatgttattggtgagccatttttaaatgtgaactgtgaacacatcaaatcatttgacaaa
aatttgtacagacaactcatctcttacccacaggaagttattccaacttttgacatggct
gtcaatgaaatcttctttgaccgttaccctgactcaatcttagaacatcagattcaagta
agaccattcaacgcattgaagactaagaatatgagaaacctgaatccagaagacattgac
cagctcatcaccatcagcggcatggtgatcaggacatcccagctgattcccgagatgcag
gaggccttcttccagtgccaagtgtgtgcccacacgacccgggtggagatggaccgcggc
cgcattgcagagcccagtgtgtgcgggcgctgccacaccacccacagcatggcactcatc
cacaaccgctccctcttctctgacaagcagatgatcaagcttcaggagtctccggaagac
atgcctgcagggcagacaccacacacagttatcctgtttgctcacaatgatctcgttgac
aaggtccagcctggggacagagtgaatgttacaggcatctatcgagctgtgcctattcga
gtcaatccaagagtgagtaatgtgaagtctgtctacaaaacccacattgatgtcattcat
tatcggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaactt
ttttcagagaaacgtgtggaattgcttaaggaactttccaggaaaccagacatttatgag
aggcttgcttcagccttggctccaagcatttatgaacatgaagatataaagaagggaatt
ttgcttcagctctttggcgggacaaggaaggattttagtcacactggaaggggcaaattt
cgggctgagatcaacatcttgctgtgtggcgaccctggtaccagcaagtcccagctgctg
cagtacgtgtacaacctcgtccccaggggccagtacacgtctgggaagggctccagtgca
gttggcctcactgcgtacgtaatgaaagaccctgagacaaggcagctggtcctgcagaca
ggtgctcttgtcctgagtgacaacggcatctgctgtatcgatgagttcgacaagatgaat
gaaagtacaagatcggtattgcatgaagtcatggaacagcagactctgtccattgcaaag
gctgggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcccatt
gagtctcagtggaatcctaaaaaaacaaccattgaaaacatccagctgcctcatacttta
ttatcaaggtttgatttgatcttcctcttgctggaccctcaggacgaagcctatgacagg
cgtctggctcaccacctggtcgcactgtactaccagagcgaggagcaggcagaggaggag
ctcctggacatggcggtgctaaaggactacattgcctacgcgcacagcaccatcatgccg
cggctaagtgaggaagccagccaggctctcatcgaggcttatgtagacatgaggaagatt
ggcagtagccggggaatggtttctgcataccctcgacagctagagtcattaatccgctta
gcagaagcccatgctaaagtaagattgtctaacaaagttgaagccattgatgtggaagag
gccaaacgcctccatcgggaagctctgaagcagtctgcaactgatccccggactggcatc
gtggacatatctattcttactacggggatgagtgccacctctcgtaaacggaaagaagaa
ttagctgaagcattgaaaaagcttattttatctaagggcaaaacaccagctctaaaatac
cagcaactttttgaagatattcggggacaatctgacatagcaattactaaagatatgttt
gaagaagcactgcgtgccctggcagatgatgatttcctgacagtgactgggaagaccgtg
cgcttgctctga

DBGET integrated database retrieval system