KEGG   Homo sapiens (human): 4174Help
Entry
4174              CDS       T01001                                 

Gene name
MCM5, CDC46, P1-CDC46
Definition
(RefSeq) minichromosome maintenance complex component 5 (EC:3.6.4.12)
  KO
K02209  
DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4174 (MCM5)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4174 (MCM5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4174 (MCM5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4174 (MCM5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4174 (MCM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 734 aa AA seqDB search
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagcgacagcttcgggggcgacgcccag
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgcacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctgggggagtactggattgaggtggagatggaggatctggccagcttt
gatgaggacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtagctgatgaggtgacccggccccggccttctggggaggaggtg
ctccaggacatccaggtcatgctcaagtcggacgccagcccttccagcattcgtagcctg
aagtcggacatgatgtcacacctggtgaagatccctggcatcatcatcgcggcctctgcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgcaacaccctcacc
aacattgccatgcgccctggcctcgagggctatgccctgcccaggaagtgcaacacagat
caggctgggcgccccaaatgcccattggacccgtacttcatcatgcccgacaaatgcaaa
tgcgtggacttccagaccctgaagctgcaggagctgcctgatgcagtcccccacggggag
atgcccagacacatgcagctctactgcgacaggtacctgtgtgacaaggtcgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgactaccagcagg
ggccgtgacagggtgggcgtgggcatccgaagctcctacatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccccaggaggaggag
gagttccgtcgcctggctgccctcccaaatgtctatgaggtcatctccaagagcatcgcc
ccctccatctttgggggcacagacatgaagaaggccattgcctgcctgctctttgggggc
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtatacacgtctgggaaaggcagcagcgcagctggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggagggcggagccatggtcctggccgatggtggg
gtcgtctgtattgacgagtttgacaagatgcgagaagatgaccgtgtggcaatccacgaa
gccatggagcagcagaccatctctatcgccaaggctgggatcaccaccaccctgaactcc
cgctgctccgtcctggctgctgccaactcagtgttcggccgctgggatgagacgaagggg
gaggacaacattgacttcatgcccaccatcttgtcgcgcttcgacatgatcttcatcgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcatcactctgcac
gtgagcgcactgacacagacacaggctgtggagggcgagattgacctggccaagctgaag
aagtttattgcctactgccgagtgaagtgtggcccccggctgtcagcagaggctgcagag
aaactgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgcatcgcg
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcatcatcaaggacttcaccaag
cagaaatacccggagcacgccatccacaaggtgctgcagctcatgctgcggcgcggcgag
atccagcatcgcatgcagcgcaaggttctctaccgcctcaagtga

DBGET integrated database retrieval system