KEGG   Homo sapiens (human): 4174Help
Entry
4174              CDS       T01001                                 

Gene name
MCM5, CDC46, P1-CDC46
Definition
minichromosome maintenance complex component 5 (EC:3.6.4.12)
Orthology
K02209  
DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4174 (MCM5)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4174 (MCM5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4174 (MCM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 734 aa AA seqDB search
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagcgacagcttcgggggcgacgcccag
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgcacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctgggggagtactggattgaggtggagatggaggatctggccagcttt
gatgaggacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtagctgatgaggtgacccggccccggccttctggggaggaggtg
ctccaggacatccaggtcatgctcaagtcggacgccagcccttccagcattcgtagcctg
aagtcggacatgatgtcacacctggtgaagatccctggcatcatcatcgcggcctctgcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgcaacaccctcacc
aacattgccatgcgccctggcctcgagggctatgccctgcccaggaagtgcaacacagat
caggctgggcgccccaaatgcccattggacccgtacttcatcatgcccgacaaatgcaaa
tgcgtggacttccagaccctgaagctgcaggagctgcctgatgcagtcccccacggggag
atgcccagacacatgcagctctactgcgacaggtacctgtgtgacaaggtcgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgactaccagcagg
ggccgtgacagggtgggcgtgggcatccgaagctcctacatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccccaggaggaggag
gagttccgtcgcctggctgccctcccaaatgtctatgaggtcatctccaagagcatcgcc
ccctccatctttgggggcacagacatgaagaaggccattgcctgcctgctctttgggggc
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtatacacgtctgggaaaggcagcagcgcagctggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggagggcggagccatggtcctggccgatggtggg
gtcgtctgtattgacgagtttgacaagatgcgagaagatgaccgtgtggcaatccacgaa
gccatggagcagcagaccatctctatcgccaaggctgggatcaccaccaccctgaactcc
cgctgctccgtcctggctgctgccaactcagtgttcggccgctgggatgagacgaagggg
gaggacaacattgacttcatgcccaccatcttgtcgcgcttcgacatgatcttcatcgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcatcactctgcac
gtgagcgcactgacacagacacaggctgtggagggcgagattgacctggccaagctgaag
aagtttattgcctactgccgagtgaagtgtggcccccggctgtcagcagaggctgcagag
aaactgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgcatcgcg
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcatcatcaaggacttcaccaag
cagaaatacccggagcacgccatccacaaggtgctgcagctcatgctgcggcgcggcgag
atccagcatcgcatgcagcgcaaggttctctaccgcctcaagtga

DBGET integrated database retrieval system