KEGG   Homo sapiens (human): 4174Help
Entry
4174              CDS       T01001                                 

Gene name
MCM5, CDC46, P1-CDC46
Definition
minichromosome maintenance complex component 5 (EC:3.6.4.12)
Orthology
K02209  
DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 734 aa AA seqDB search
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcgacgatcctggcattttctacagcgacagcttcgggggcgacgcccag
gccgacgaggggcaggcccgcaaatcgcagctgcagaggcgcttcaaggagttcctgcgg
cagtaccgagtgggcaccgaccgcacgggcttcaccttcaaatacagggatgaactcaag
cggcattacaacctgggggagtactggattgaggtggagatggaggatctggccagcttt
gatgaggacctggccgactacttgtacaagcagccagccgagcacctgcagctgctggag
gaagctgccaaggaggtagctgatgaggtgacccggccccggccttctggggaggaggtg
ctccaggacatccaggtcatgctcaagtcggacgccagcccttccagcattcgtagcctg
aagtcggacatgatgtcacacctggtgaagatccctggcatcatcatcgcggcctctgcg
gtccgtgccaaggccacccgcatctctatccagtgccgcagctgccgcaacaccctcacc
aacattgccatgcgccctggcctcgagggctatgccctgcccaggaagtgcaacacagat
caggctgggcgccccaaatgcccattggacccgtacttcatcatgcccgacaaatgcaaa
tgcgtggacttccagaccctgaagctgcaggagctgcctgatgcagtcccccacggggag
atgcccagacacatgcagctctactgcgacaggtacctgtgtgacaaggtcgtccctggg
aacagggttaccatcatgggcatctactccatcaagaagtttggcctgactaccagcagg
ggccgtgacagggtgggcgtgggcatccgaagctcctacatccgtgtcctgggcatccag
gtggacacagatggctctggccgcagctttgctggggccgtgagcccccaggaggaggag
gagttccgtcgcctggctgccctcccaaatgtctatgaggtcatctccaagagcatcgcc
ccctccatctttgggggcacagacatgaagaaggccattgcctgcctgctctttgggggc
tcccgaaagaggctccctgatggacttactcgccgaggagacatcaacctgctgatgcta
ggggaccctgggacagccaagtcccagcttctgaagtttgtggagaagtgttctcccatt
ggggtatacacgtctgggaaaggcagcagcgcagctggactgacagcctcggtgatgagg
gacccttcgtcccggaatttcatcatggagggcggagccatggtcctggccgatggtggg
gtcgtctgtattgacgagtttgacaagatgcgagaagatgaccgtgtggcaatccacgaa
gccatggagcagcagaccatctctatcgccaaggctgggatcaccaccaccctgaactcc
cgctgctccgtcctggctgctgccaactcagtgttcggccgctgggatgagacgaagggg
gaggacaacattgacttcatgcccaccatcttgtcgcgcttcgacatgatcttcatcgtc
aaggatgagcacaatgaggagagggatgtgatgctggccaagcatgtcatcactctgcac
gtgagcgcactgacacagacacaggctgtggagggcgagattgacctggccaagctgaag
aagtttattgcctactgccgagtgaagtgtggcccccggctgtcagcagaggctgcagag
aaactgaagaaccgctacatcatcatgcggagcggggcccgtcagcacgagagggacagt
gaccgccgctccagcatccccatcactgtgcggcagctggaggccattgtgcgcatcgcg
gaagccctcagcaagatgaagctgcagcccttcgccacagaggcagatgtggaggaggcc
ctgcggctcttccaagtgtccacgttggatgctgccttgtccggtaccctgtcaggggtg
gagggcttcaccagccaggaggaccaggagatgctgagccgcatcgagaagcagctcaag
cgccgctttgccattggctcccaggtgtctgagcacagcatcatcaaggacttcaccaag
cagaaatacccggagcacgccatccacaaggtgctgcagctcatgctgcggcgcggcgag
atccagcatcgcatgcagcgcaaggttctctaccgcctcaagtga

DBGET integrated database retrieval system