KEGG   Homo sapiens (human): 4175Help
Entry
4175              CDS       T01001                                 

Gene name
MCM6, MCG40308, Mis5, P105MCM
Definition
minichromosome maintenance complex component 6 (EC:3.6.4.12)
Orthology
K02542  
DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4175 (MCM6)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4175 (MCM6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4175 (MCM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q21
AA seq 821 aa AA seqDB search
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcggcggcagcggagccgggcgccggcagccagcacctggaggtccgcgac
gaggtggccgagaagtgccagaaactgttcctggacttcttggaggagtttcagagcagc
gatggagaaattaaatacttgcaattagcagaggaactgattcgtcctgagagaaacaca
ttggttgtgagttttgtggacctggaacaatttaaccagcaactttccaccaccattcaa
gaggagttctatagagtttacccttacctgtgtcgggccttgaaaacattcgtcaaagac
cgtaaagagatccctcttgccaaggatttttatgttgcattccaagacctgcctaccaga
cacaagattcgagagctcacctcatccagaattggtttgctcactcgcatcagtgggcag
gtggtgcggactcacccagttcacccagagcttgtgagcggaacttttctgtgcttggac
tgtcagacagtgatcagggatgtagaacagcagttcaaatacacacagccaaacatctgc
cgaaatccagtttgtgccaacaggaggagattcttactggatacaaataaatcaagattt
gttgattttcaaaaggttcgtattcaagagacccaagctgagcttcctcgagggagtatc
ccccgcagtttagaagtaattttaagggctgaagctgtggaatcagctcaagctggtgac
aagtgtgactttacagggacactgattgttgtgcctgacgtctccaagcttagcacacca
ggagcacgtgcagaaactaattcccgtgtcagtggtgttgatggatatgagacagaaggc
attcgaggactccgggcccttggtgttagggacctttcttataggctggtctttcttgcc
tgctgtgttgcgccaaccaacccaaggtttggggggaaagagctcagagatgaggaacag
acagctgagagcattaagaaccaaatgactgtgaaagaatgggagaaagtgtttgagatg
agtcaagataaaaatctataccacaatctttgtaccagcctgttccctactatacatggc
aatgatgaagtaaaacggggtgtcctgctgatgctctttggtggcgttccaaagacaaca
ggagaagggacctctcttcgaggggacataaatgtttgcattgttggtgacccaagtaca
gctaagagccaatttctcaagcacgtggaggagttcagccccagagctgtctacaccagt
ggtaaagcgtccagtgctgctggcttaacagcagctgttgtgagagatgaagaatctcat
gagtttgtcattgaggctggagctttgatgttggctgataatggtgtgtgttgtattgat
gaatttgataagatggacgtgcgggatcaagttgctattcatgaagctatggaacagcag
accatatccatcactaaagcaggagtgaaggctactctgaacgcccggacgtccattttg
gcagcagcaaacccaatcagtggacactatgacagatcaaaatcattgaaacagaatata
aatttgtcagctcccatcatgtcccgattcgatctcttctttatccttgtggatgaatgt
aatgaggttacagattatgccattgccaggcgcatagtagatttgcattcaagaattgag
gaatcaattgatcgtgtctattccctcgatgatatcagaagatatcttctctttgcaaga
cagtttaaacccaagatttccaaagagtcagaggacttcattgtggagcaatataaacat
ctccgccagagagatggttctggagtgaccaagtcttcatggaggattacagtgcgacag
cttgagagcatgattcgtctctctgaagctatggctcggatgcactgctgtgatgaggtc
caacctaaacatgtgaaggaagctttccggttactgaataaatcaatcatccgtgtggaa
acacctgatgtcaatctagatcaagaggaagagatccagatggaggtagatgagggtgct
ggtggcatcaatggtcatgctgacagccctgctcctgtgaacgggatcaatggctacaat
gaagacataaatcaagagtctgctcccaaagcctccttaaggctgggcttctctgagtac
tgccgaatctctaaccttattgtgcttcacctcagaaaggtggaagaagaagaggacgag
tcagcattaaagaggagcgagcttgttaactggtacttgaaggaaatcgaatcagagata
gactctgaagaagaacttataaataaaaaaagaatcatagagaaagttattcatcgactc
acacactatgatcatgttctaattgagctcacccaggctggattgaaaggctccacagag
ggaagtgagagctatgaagaagatccctacttggtagttaaccctaactacttgctcgaa
gattga

  All links  
No link information was found.   
DBGET integrated database retrieval system