KEGG   Homo sapiens (human): 4175Help
Entry
4175              CDS       T01001                                 

Gene name
MCM6, MCG40308, Mis5, P105MCM
Definition
minichromosome maintenance complex component 6 (EC:3.6.4.12)
Orthology
K02542  
DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Cell cycle
Module
MCM complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q21
AA seq 821 aa AA seqDB search
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcggcggcagcggagccgggcgccggcagccagcacctggaggtccgcgac
gaggtggccgagaagtgccagaaactgttcctggacttcttggaggagtttcagagcagc
gatggagaaattaaatacttgcaattagcagaggaactgattcgtcctgagagaaacaca
ttggttgtgagttttgtggacctggaacaatttaaccagcaactttccaccaccattcaa
gaggagttctatagagtttacccttacctgtgtcgggccttgaaaacattcgtcaaagac
cgtaaagagatccctcttgccaaggatttttatgttgcattccaagacctgcctaccaga
cacaagattcgagagctcacctcatccagaattggtttgctcactcgcatcagtgggcag
gtggtgcggactcacccagttcacccagagcttgtgagcggaacttttctgtgcttggac
tgtcagacagtgatcagggatgtagaacagcagttcaaatacacacagccaaacatctgc
cgaaatccagtttgtgccaacaggaggagattcttactggatacaaataaatcaagattt
gttgattttcaaaaggttcgtattcaagagacccaagctgagcttcctcgagggagtatc
ccccgcagtttagaagtaattttaagggctgaagctgtggaatcagctcaagctggtgac
aagtgtgactttacagggacactgattgttgtgcctgacgtctccaagcttagcacacca
ggagcacgtgcagaaactaattcccgtgtcagtggtgttgatggatatgagacagaaggc
attcgaggactccgggcccttggtgttagggacctttcttataggctggtctttcttgcc
tgctgtgttgcgccaaccaacccaaggtttggggggaaagagctcagagatgaggaacag
acagctgagagcattaagaaccaaatgactgtgaaagaatgggagaaagtgtttgagatg
agtcaagataaaaatctataccacaatctttgtaccagcctgttccctactatacatggc
aatgatgaagtaaaacggggtgtcctgctgatgctctttggtggcgttccaaagacaaca
ggagaagggacctctcttcgaggggacataaatgtttgcattgttggtgacccaagtaca
gctaagagccaatttctcaagcacgtggaggagttcagccccagagctgtctacaccagt
ggtaaagcgtccagtgctgctggcttaacagcagctgttgtgagagatgaagaatctcat
gagtttgtcattgaggctggagctttgatgttggctgataatggtgtgtgttgtattgat
gaatttgataagatggacgtgcgggatcaagttgctattcatgaagctatggaacagcag
accatatccatcactaaagcaggagtgaaggctactctgaacgcccggacgtccattttg
gcagcagcaaacccaatcagtggacactatgacagatcaaaatcattgaaacagaatata
aatttgtcagctcccatcatgtcccgattcgatctcttctttatccttgtggatgaatgt
aatgaggttacagattatgccattgccaggcgcatagtagatttgcattcaagaattgag
gaatcaattgatcgtgtctattccctcgatgatatcagaagatatcttctctttgcaaga
cagtttaaacccaagatttccaaagagtcagaggacttcattgtggagcaatataaacat
ctccgccagagagatggttctggagtgaccaagtcttcatggaggattacagtgcgacag
cttgagagcatgattcgtctctctgaagctatggctcggatgcactgctgtgatgaggtc
caacctaaacatgtgaaggaagctttccggttactgaataaatcaatcatccgtgtggaa
acacctgatgtcaatctagatcaagaggaagagatccagatggaggtagatgagggtgct
ggtggcatcaatggtcatgctgacagccctgctcctgtgaacgggatcaatggctacaat
gaagacataaatcaagagtctgctcccaaagcctccttaaggctgggcttctctgagtac
tgccgaatctctaaccttattgtgcttcacctcagaaaggtggaagaagaagaggacgag
tcagcattaaagaggagcgagcttgttaactggtacttgaaggaaatcgaatcagagata
gactctgaagaagaacttataaataaaaaaagaatcatagagaaagttattcatcgactc
acacactatgatcatgttctaattgagctcacccaggctggattgaaaggctccacagag
ggaagtgagagctatgaagaagatccctacttggtagttaaccctaactacttgctcgaa
gattga

DBGET integrated database retrieval system